Mouse ATP6AP1 Monoclonal Antibody | anti-ATP6AP1 antibody

ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1, 16A, ATP6IP1, ATP6S1, Ac45, CF2, MGC129781, VATPS1, XAP-3, XAP3) (AP)

Cat. Num. AAA6165051

• Gene Names: ATP6AP1; 16A; CF2; Ac45; XAP3; XAP-3; ATP6S1; VATPS1; ATP6IP1
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: ATP6AP1; Monoclonal Antibody; ATP6AP1 (ATPase; H+ Transporting; Lysosomal Accessory Protein 1; 16A; ATP6IP1; ATP6S1; Ac45; CF2; MGC129781; VATPS1; XAP-3; XAP3) (AP); ATPase; XAP3; anti-ATP6AP1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B11
• Specificity: Recognizes ATP6AP1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ATP6AP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ATP6AP1 (NP_001174, 51aa-150aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody (M02), clone 3B11.Lane 1: ATP6AP1 transfected lysate (Predicted MW: 52 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-ATP6AP1 antibody

This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. [provided by RefSeq]

Product Categories/Family for anti-ATP6AP1 antibody

Antibodies; Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 17136148
• NCBI GeneID: 537
• NCBI Accession #: NP_001174
• NCBI GenBank Nucleotide #: NM_001183
• UniProt Accession #: Q15904
• Molecular Weight: 52
• NCBI Official Full Name: V-type proton ATPase subunit S1
• NCBI Official Synonym Full Names: ATPase H+ transporting accessory protein 1
• NCBI Official Symbol: ATP6AP1
• NCBI Official Synonym Symbols: 16A; CF2; Ac45; XAP3; XAP-3; ATP6S1; VATPS1; ATP6IP1
• NCBI Protein Information: V-type proton ATPase subunit S1
• UniProt Protein Name: V-type proton ATPase subunit S1
• Protein Family: V-type proton ATPase
• UniProt Gene Name: ATP6AP1
• UniProt Synonym Gene Names: ATP6IP1; ATP6S1; VATPS1; XAP3; V-ATPase subunit S1
• UniProt Entry Name: VAS1_HUMAN

NCBI Description

This gene encodes a component of a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. This protein may also play a role in early development. [provided by RefSeq, Aug 2013]

Uniprot Description

ATP6AP1: Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the vacuolar ATPase subunit S1 family.

Protein type: Transporter; EC 3.6.3.14; Energy Metabolism - oxidative phosphorylation; Hydrolase; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: vacuolar membrane; integral to membrane; endosome membrane; proton-transporting two-sector ATPase complex

Molecular Function: transporter activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; hydrogen ion transporting ATPase activity, rotational mechanism; Rab GTPase binding; ATP binding

Biological Process: positive regulation of osteoblast differentiation; proton transport; cellular iron ion homeostasis; ATP hydrolysis coupled proton transport; pH reduction; insulin receptor signaling pathway; positive regulation of bone resorption; transferrin transport; transmembrane transport; establishment of organelle localization; positive regulation of exocytosis