NACHT, LRR and PYD domains-containing protein 3 Recombinant Protein | Nlrp3 recombinant protein

Recombinant Mouse NACHT, LRR and PYD domains-containing protein 3 (NIrp3), partial

Cat. Num. AAA1448454

• Gene Names: Nlrp3; FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: NACHT; LRR and PYD domains-containing protein 3; Recombinant Mouse NACHT; LRR and PYD domains-containing protein 3 (NIrp3); partial; Cold autoinflammatory syndrome 1 protein homolog; Cryopyrin; Mast cell maturation-associated-inducible protein 1; PYRIN-containing APAF1-like protein 1; Nlrp3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-153aa; Partial
• Sequence: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR
• Sequence Length: 153

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Nlrp3 recombinant protein

May function as an inducer of apoptosis. Interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling. Inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA (By similarity). Activates caspase-1 as part of the NALP3 inflammasome complex in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18.

References

"Induction of PYPAF1 during in vitro maturation of mouse mast cells." Kikuchi-Yanoshita R., Taketomi Y., Koga K., Sugiki T., Atsumi Y., Saito T., Ishii S., Hisada M., Suzuki-Nishimura T., Uchida M.K., Moon T.-C., Chang H.-W., Sawada M., Inagaki N., Nagai H., Murakami M., Kudo I. J. Biochem. 134:699-709(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 22003870
• NCBI GeneID: 216799
• NCBI Accession #: NP_665826.1
• NCBI GenBank Nucleotide #: NM_145827.3
• UniProt Accession #: Q8R4B8; Q1JQ87; Q1JQ88; Q6JEL0; T1W2H6
• Molecular Weight: 34.2 kDa
• NCBI Official Full Name: NACHT, LRR and PYD domains-containing protein 3
• NCBI Official Synonym Full Names: NLR family, pyrin domain containing 3
• NCBI Official Symbol: Nlrp3
• NCBI Official Synonym Symbols: FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL
• NCBI Protein Information: NACHT, LRR and PYD domains-containing protein 3
• UniProt Protein Name: NACHT, LRR and PYD domains-containing protein 3
• Protein Family: NACHT, LRR and PYD domains-containing protein
• UniProt Gene Name: Nlrp3
• UniProt Synonym Gene Names: Cias1; Mmig1; Nalp3; Pypaf1
• UniProt Entry Name: NLRP3_MOUSE

Uniprot Description

NLRP3: May function as an inducer of apoptosis. Interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling. Inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA. Activates caspase-1 in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18. Defects in NLRP3 are the cause of familial cold autoinflammatory syndrome type 1 (FCAS1); also known as familial cold urticaria. FCAS are rare autosomal dominant systemic inflammatory diseases characterized by episodes of rash, arthralgia, fever and conjunctivitis after generalized exposure to cold. Defects in NLRP3 are a cause of Muckle-Wells syndrome (MWS); also known as urticaria-deafness-amyloidosis syndrome. MWS is a hereditary periodic fever syndrome characterized by fever, chronic recurrent urticaria, arthralgias, progressive sensorineural deafness, and reactive renal amyloidosis. The disease may be severe if generalized amyloidosis occurs. Defects in NLRP3 are the cause of chronic infantile neurologic cutaneous and articular syndrome (CINCA); also known as neonatal onset multisystem inflammatory disease (NOMID). CINCA is a rare congenital inflammatory disorder characterized by a triad of neonatal onset of cutaneous symptoms, chronic meningitis and joint manifestations with recurrent fever and inflammation. Belongs to the NLRP family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Inhibitor

Cellular Component: cytoplasm; endoplasmic reticulum; extracellular region; nucleus

Molecular Function: ATP binding; nucleotide binding; protein binding; sequence-specific DNA binding; transcription factor binding

Biological Process: activation of NF-kappaB transcription factor; caspase activation; defense response to virus; immune system process; inflammatory response; inhibition of NF-kappaB transcription factor; innate immune response; interleukin-1 beta production; interleukin-1 secretion; interleukin-18 production; negative regulation of acute inflammatory response; negative regulation of inflammatory response; negative regulation of interleukin-1 beta secretion; negative regulation of NF-kappaB import into nucleus; positive regulation of caspase activity; positive regulation of interleukin-1 beta secretion; positive regulation of interleukin-13 production; positive regulation of interleukin-4 production; positive regulation of interleukin-5 production; positive regulation of T-helper 2 cell differentiation; positive regulation of T-helper 2 type immune response; positive regulation of transcription from RNA polymerase II promoter; regulation of inflammatory response; regulation of transcription, DNA-dependent; transcription, DNA-dependent