Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Mouse anti-Human ATP11B Monoclonal Antibody | anti-ATP11B antibody

ATP11B (Probable Phospholipid-transporting ATPase IF, ATPase IR, ATPase Class VI Type 11B, ATPIF, ATPIR, KIAA0956) (PE)

Gene Names
ATP11B; ATPIF; ATPIR
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP11B; Monoclonal Antibody; ATP11B (Probable Phospholipid-transporting ATPase IF; ATPase IR; ATPase Class VI Type 11B; ATPIF; ATPIR; KIAA0956) (PE); anti-ATP11B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4H8
Specificity
Recognizes human ATP11B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ATP11B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1087-1178 from ATP11B (NP_055431) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.12kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)
Related Product Information for anti-ATP11B antibody
Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IV subfamily.
Product Categories/Family for anti-ATP11B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
134,190 Da
NCBI Official Full Name
probable phospholipid-transporting ATPase IF
NCBI Official Synonym Full Names
ATPase, class VI, type 11B
NCBI Official Symbol
ATP11B
NCBI Official Synonym Symbols
ATPIF; ATPIR
NCBI Protein Information
probable phospholipid-transporting ATPase IF; ATPase IR; truncated ATPase 11B protein; P4-ATPase flippase complex alpha subunit ATP11B
UniProt Protein Name
Probable phospholipid-transporting ATPase IF
UniProt Gene Name
ATP11B
UniProt Synonym Gene Names
ATPIF; ATPIR; KIAA0956
UniProt Entry Name
AT11B_HUMAN

NCBI Description

P-type ATPases, such as ATP11B, are phosphorylated in their intermediate state and drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily transports heavy metal ions, such as Cu(2+) or Cd(2+). Another subfamily transports non-heavy metal ions, such as H(+), Na(+), K(+), or Ca(+). A third subfamily transports amphipaths, such as phosphatidylserine.[supplied by OMIM, Feb 2005]

Uniprot Description

ATP11B: Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IV subfamily. Interacts with TMEM30A

Protein type: Hydrolase; Transporter, ion channel; Membrane protein, multi-pass; Membrane protein, integral; Transporter; EC 3.6.3.1

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: Golgi apparatus; recycling endosome; membrane; recycling endosome membrane; endoplasmic reticulum; early endosome; integral to membrane; plasma membrane; nuclear inner membrane

Molecular Function: phospholipid-translocating ATPase activity; protein binding; ion transmembrane transporter activity; magnesium ion binding; ATP binding

Biological Process: phospholipid translocation; metabolic process; aminophospholipid transport; ion transport; transmembrane transport

Research Articles on ATP11B

Similar Products

Product Notes

The ATP11B atp11b (Catalog #AAA6156636) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP11B (Probable Phospholipid-transporting ATPase IF, ATPase IR, ATPase Class VI Type 11B, ATPIF, ATPIR, KIAA0956) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP11B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP11B atp11b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP11B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.