Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PLSCR3 rabbit polyclonal antibody. Western Blot analysis of PLSCR3 expression in human pancreas.)

Rabbit anti-Human, Mouse PLSCR3 Polyclonal Antibody | anti-PLSCR3 antibody

PLSCR3 (Phospholipid Scramblase 3, PL Scramblase 3, Ca(2+)-dependent Phospholipid Scramblase 3) APC

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLSCR3; Polyclonal Antibody; PLSCR3 (Phospholipid Scramblase 3; PL Scramblase 3; Ca(2+)-dependent Phospholipid Scramblase 3) APC; anti-PLSCR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PLSCR3. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1615
Applicable Applications for anti-PLSCR3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PLSCR3, aa1-295 (AAH11735.1).
Immunogen Sequence
MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PLSCR3 rabbit polyclonal antibody. Western Blot analysis of PLSCR3 expression in human pancreas.)

Western Blot (WB) (PLSCR3 rabbit polyclonal antibody. Western Blot analysis of PLSCR3 expression in human pancreas.)

Western Blot (WB)

(PLSCR3 rabbit polyclonal antibody. Western Blot analysis of PLSCR3 expression in mouse brain.)

Western Blot (WB) (PLSCR3 rabbit polyclonal antibody. Western Blot analysis of PLSCR3 expression in mouse brain.)

Western Blot (WB)

(Western Blot analysis of PLSCR3 expression in transfected 293T cell line by PLSCR3 polyclonal antibody. Lane 1: PLSCR3 transfected lysate (31.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PLSCR3 expression in transfected 293T cell line by PLSCR3 polyclonal antibody. Lane 1: PLSCR3 transfected lysate (31.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PLSCR3 antibody
May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Seems to play a role in apoptosis, through translocation of cardiolipin from the inner to the outer mitochondrial membrane which promotes BID recruitment and enhances tBid-induced mitochondrial damages.
Product Categories/Family for anti-PLSCR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens phospholipid scramblase 3, mRNA
NCBI Official Synonym Full Names
phospholipid scramblase 3
NCBI Official Symbol
PLSCR3
NCBI Protein Information
phospholipid scramblase 3
Protein Family

Research Articles on PLSCR3

Similar Products

Product Notes

The PLSCR3 (Catalog #AAA6389868) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLSCR3 (Phospholipid Scramblase 3, PL Scramblase 3, Ca(2+)-dependent Phospholipid Scramblase 3) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PLSCR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLSCR3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLSCR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.