Mouse anti-Human ASPA Monoclonal Antibody | anti-ASPA antibody

ASPA (Aspartoacylase, Aminoacylase-2, ACY-2, ACY2, ASP) (FITC)

Cat. Num. AAA6146010

• Gene Names: ASPA; ASP; ACY2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ASPA; Monoclonal Antibody; ASPA (Aspartoacylase; Aminoacylase-2; ACY-2; ACY2; ASP) (FITC); anti-ASPA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3C11
• Specificity: Recognizes human ASPA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ASPA antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human ASPA (NP_000040) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLF
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ASPA on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ASPA is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-ASPA antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 4557335
• NCBI GeneID: 443
• NCBI Accession #: NP_000040
• NCBI GenBank Nucleotide #: NM_000049
• UniProt Accession #: P45381
• Molecular Weight: 38.1 kDa (336aa), confirmed by MALDI-TOF
• NCBI Official Full Name: aspartoacylase
• NCBI Official Synonym Full Names: aspartoacylase
• NCBI Official Symbol: ASPA
• NCBI Official Synonym Symbols: ASP; ACY2
• NCBI Protein Information: aspartoacylase
• UniProt Protein Name: Aspartoacylase
• Protein Family: Aspartocin
• UniProt Gene Name: ASPA
• UniProt Synonym Gene Names: ACY2; ASP; ACY-2
• UniProt Entry Name: ACY2_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ASPA: Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids. Defects in ASPA are the cause of Canavan disease (CAND); also known as spongy degeneration of the brain. CAND is a rare neurodegenerative condition of infancy or childhood characterized by white matter vacuolization and demeylination that gives rise to a spongy appearance. The clinical features are onset in early infancy, atonia of neck muscles, hypotonia, hyperextension of legs and flexion of arms, blindness, severe mental defect, megalocephaly, and death by 18 months on the average. Belongs to the AspA/AstE family. Aspartoacylase subfamily.

Protein type: Hydrolase; Amino Acid Metabolism - alanine, aspartate and glutamate; Amino Acid Metabolism - histidine; EC 3.5.1.15

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; metal ion binding; hydrolase activity, acting on ester bonds; aspartoacylase activity; aminoacylase activity

Biological Process: myelination in the central nervous system; aspartate catabolic process; positive regulation of oligodendrocyte differentiation

Disease: Canavan Disease