Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human ASPA Monoclonal Antibody | anti-ASPA antibody

ASPA (Aspartoacylase, Aminoacylase-2, ACY-2, ACY2, ASP) APC

Gene Names
ASPA; ASP; ACY2
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ASPA; Monoclonal Antibody; ASPA (Aspartoacylase; Aminoacylase-2; ACY-2; ACY2; ASP) APC; anti-ASPA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C11
Specificity
Recognizes human ASPA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ASPA antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human ASPA (NP_000040) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ASPA on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ASPA on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ASPA is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ASPA is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-ASPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
443
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.1 kDa (336aa), confirmed by MALDI-TOF
NCBI Official Full Name
aspartoacylase
NCBI Official Synonym Full Names
aspartoacylase
NCBI Official Symbol
ASPA
NCBI Official Synonym Symbols
ASP; ACY2
NCBI Protein Information
aspartoacylase
UniProt Protein Name
Aspartoacylase
Protein Family
UniProt Gene Name
ASPA
UniProt Synonym Gene Names
ACY2; ASP; ACY-2
UniProt Entry Name
ACY2_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ASPA: Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids. Defects in ASPA are the cause of Canavan disease (CAND); also known as spongy degeneration of the brain. CAND is a rare neurodegenerative condition of infancy or childhood characterized by white matter vacuolization and demeylination that gives rise to a spongy appearance. The clinical features are onset in early infancy, atonia of neck muscles, hypotonia, hyperextension of legs and flexion of arms, blindness, severe mental defect, megalocephaly, and death by 18 months on the average. Belongs to the AspA/AstE family. Aspartoacylase subfamily.

Protein type: Hydrolase; Amino Acid Metabolism - alanine, aspartate and glutamate; Amino Acid Metabolism - histidine; EC 3.5.1.15

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; metal ion binding; hydrolase activity, acting on ester bonds; aspartoacylase activity; aminoacylase activity

Biological Process: myelination in the central nervous system; aspartate catabolic process; positive regulation of oligodendrocyte differentiation

Disease: Canavan Disease

Research Articles on ASPA

Similar Products

Product Notes

The ASPA aspa (Catalog #AAA6135404) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASPA (Aspartoacylase, Aminoacylase-2, ACY-2, ACY2, ASP) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASPA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASPA aspa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASPA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.