Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TRIM21 Antibody Titration: 1.25ug/mlPositive Control: Transfected 293T)

Rabbit TRIM21 Polyclonal Antibody | anti-TRIM21 antibody

TRIM21 antibody - C-terminal region

Gene Names
TRIM21; SSA; RO52; SSA1; RNF81; Ro/SSA
Reactivity
Cow, Guinea Pig, Horse, Human, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
TRIM21; Polyclonal Antibody; TRIM21 antibody - C-terminal region; anti-TRIM21 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ
Sequence Length
475
Applicable Applications for anti-TRIM21 antibody
Western Blot (WB)
Homology
Cow: 77%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Pig: 85%; Rat: 77%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM21
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TRIM21 Antibody Titration: 1.25ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-TRIM21 Antibody Titration: 1.25ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-TRIM21 antibody
This is a rabbit polyclonal antibody against TRIM21. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRIM21 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM21 is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM21
NCBI Official Synonym Full Names
tripartite motif containing 21
NCBI Official Symbol
TRIM21
NCBI Official Synonym Symbols
SSA; RO52; SSA1; RNF81; Ro/SSA
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM21
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM21
UniProt Gene Name
TRIM21
UniProt Synonym Gene Names
RNF81; RO52; SSA1; SS-A
UniProt Entry Name
RO52_HUMAN

NCBI Description

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TRIM21: E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)- like complex is shown to mediate ubiquitination of CDKN1B ('Thr- 187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin- mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs.2. Belongs to the TRIM/RBCC family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; EC 6.3.2.-; Ligase; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: nucleoplasm; cytoplasm; SCF ubiquitin ligase complex; cytosol; nucleus; ribonucleoprotein complex

Molecular Function: identical protein binding; protein binding; DNA binding; zinc ion binding; RNA binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: protein monoubiquitination; regulation of interferon type I production; negative regulation of viral transcription; protein autoubiquitination; protein polyubiquitination; positive regulation of virion penetration into host cell; protein destabilization; inhibition of NF-kappaB transcription factor; cytokine and chemokine mediated signaling pathway; positive regulation of interferon type I production; protein ubiquitination; innate immune response; positive regulation of cell cycle; positive regulation of transcription factor activity; cell cycle

Research Articles on TRIM21

Similar Products

Product Notes

The TRIM21 trim21 (Catalog #AAA3203980) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM21 antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM21 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIM21 trim21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YNITDHGSLI YSFSECAFTG PLRPFFSPGF NDGGKNTAPL TLCPLNIGSQ. It is sometimes possible for the material contained within the vial of "TRIM21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.