Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human, Rat ASAP1 Monoclonal Antibody | anti-ASAP1 antibody

ASAP1 (Arf-GAP with SH3 Domain, ANK Repeat and PH Domain-containing Protein 1, 130kD Phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating Protein, ADP-ribosylation Factor-directed GTPase-activating Protein 1, ARF GTPase-activating Protein

Gene Names
ASAP1; PAP; PAG2; AMAP1; DDEF1; ZG14P; CENTB4
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ASAP1; Monoclonal Antibody; ASAP1 (Arf-GAP with SH3 Domain; ANK Repeat and PH Domain-containing Protein 1; 130kD Phosphatidylinositol 4; 5-biphosphate-dependent ARF1 GTPase-activating Protein; ADP-ribosylation Factor-directed GTPase-activating Protein 1; ARF GTPase-activating Protein; anti-ASAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G7
Specificity
Recognizes human DDEF1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1129
Applicable Applications for anti-ASAP1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1030-1130 from human DDEF1 (NP_060952) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(DDEF1 monoclonal antibody. Western Blot analysis of DDEF1 expression in PC-12.)

Western Blot (WB) (DDEF1 monoclonal antibody. Western Blot analysis of DDEF1 expression in PC-12.)

Western Blot (WB)

(DDEF1 monoclonal antibody, Western Blot analysis of DDEF1 expression in IMR-32.)

Western Blot (WB) (DDEF1 monoclonal antibody, Western Blot analysis of DDEF1 expression in IMR-32.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DDEF1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DDEF1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DDEF1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DDEF1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ASAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
NCBI Official Symbol
ASAP1
NCBI Official Synonym Symbols
PAP; PAG2; AMAP1; DDEF1; ZG14P; CENTB4
NCBI Protein Information
arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
UniProt Protein Name
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
UniProt Gene Name
ASAP1
UniProt Synonym Gene Names
DDEF1; KIAA1249; ARF GTPase-activating protein 1; DEF-1
UniProt Entry Name
ASAP1_HUMAN

NCBI Description

This gene encodes an ADP-ribosylation factor (ARF) GTPase-activating protein. The GTPase-activating activity is stimulated by phosphatidylinositol 4,5-biphosphate (PIP2), and is greater towards ARF1 and ARF5, and lesser for ARF6. This gene maybe involved in regulation of membrane trafficking and cytoskeleton remodeling. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Research Articles on ASAP1

Similar Products

Product Notes

The ASAP1 asap1 (Catalog #AAA6145993) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASAP1 (Arf-GAP with SH3 Domain, ANK Repeat and PH Domain-containing Protein 1, 130kD Phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating Protein, ADP-ribosylation Factor-directed GTPase-activating Protein 1, ARF GTPase-activating Protein reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ASAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASAP1 asap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.