Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse ARF5 Monoclonal Antibody | anti-ARF5 antibody

ARF5 (ADP-ribosylation Factor 5) (AP)

Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARF5; Monoclonal Antibody; ARF5 (ADP-ribosylation Factor 5) (AP); anti-ARF5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B4
Specificity
Recognizes human ARF5. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ARF5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa81-180 from human ARF5 (AAH03043) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(ARF5 monoclonal antibody Western Blot analysis of ARF5 expression in A-431.)

Western Blot (WB) (ARF5 monoclonal antibody Western Blot analysis of ARF5 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of ARF5 expression in transfected 293T cell line by ARF5 monoclonal antibody. Lane 1: ARF5 transfected lysate (20.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ARF5 expression in transfected 293T cell line by ARF5 monoclonal antibody. Lane 1: ARF5 transfected lysate (20.5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARF5 on HeLa cell. [antibody concentration 15ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ARF5 on HeLa cell. [antibody concentration 15ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ARF5 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ARF5 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ARF5 antibody
References
1. GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis. Takashima K, Saitoh A, Hirose S, Nakai W, Kondo Y, Takasu Y, Kakeya H, Shin HW, Nakayama K.Cell Struct Funct. 2011;36(2):223-35. 2. Class II ADP-Ribosylation factors are required for efficient secretion of dengue viruses. Kudelko M, Brault JB, Kwok K, Li MY, Pardigon N, Peiris JS, Bruzzone R, Despres P, Nal B, Wang PG.J Biol Chem. 2011 Nov 21. 3. Interaction of phosphodiesterase 3A with brefeldin A-inhibited guanine nucleotide-exchange proteins BIG1 and BIG2 and effect on ARF1 activity. Puxeddu E, Uhart M, Li CC, Ahmad F, Pacheco-Rodriguez G, Manganiello VC, Moss J, Vaughan M.Proc Natl Acad Sci U S A. 2009 Apr 14;106(15):6158-63. Epub 2009 Mar 30. 4. EFA6 facilitates the assembly of the tight junction by coordinating an Arf6-dependent and independent pathway. Klein S, Partisani M, Franco M, Luton F.J Biol Chem. 2008 Oct 31;283(44):30129-38. Epub 2008 Sep 8. 5. The brefeldin A-inhibited guanine nucleotide-exchange protein, BIG2, regulates the constitutive release of TNFR1 exosome-like vesicles. Islam A, Shen X, Hiroi T, Moss J, Vaughan M, Levine SJ.J Biol Chem. 2007 Mar 30;282(13):9591-9. Epub 2007 Feb 2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
381
UniProt Accession #
Molecular Weight
20,530 Da
NCBI Official Full Name
Homo sapiens ADP-ribosylation factor 5, mRNA
NCBI Official Synonym Full Names
ADP ribosylation factor 5
NCBI Official Symbol
ARF5
NCBI Protein Information
ADP-ribosylation factor 5
UniProt Protein Name
ADP-ribosylation factor 5
Protein Family
UniProt Gene Name
ARF5
UniProt Entry Name
ARF5_HUMAN

NCBI Description

This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010]

Uniprot Description

ARF5: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP- ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein, monomeric, ARF; G protein; G protein, monomeric; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7q31.3

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; plasma membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: vesicle-mediated transport; protein transport; metabolic process; small GTPase mediated signal transduction

Research Articles on ARF5

Similar Products

Product Notes

The ARF5 arf5 (Catalog #AAA6130040) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARF5 (ADP-ribosylation Factor 5) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARF5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARF5 arf5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARF5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.