Mouse ARF5 Monoclonal Antibody | anti-ARF5 antibody

ARF5 (ADP-ribosylation Factor 5) APC

Cat. Num. AAA6135343

• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ARF5; Monoclonal Antibody; ARF5 (ADP-ribosylation Factor 5) APC; anti-ARF5 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B4
• Specificity: Recognizes human ARF5. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-ARF5 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 15ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa81-180 from human ARF5 (AAH03043) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(ARF5 monoclonal antibody Western Blot analysis of ARF5 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of ARF5 expression in transfected 293T cell line by ARF5 monoclonal antibody. Lane 1: ARF5 transfected lysate (20.5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARF5 on HeLa cell. [antibody concentration 15ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ARF5 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-ARF5 antibody

Antibodies; Transport Proteins

References

1. GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis. Takashima K, Saitoh A, Hirose S, Nakai W, Kondo Y, Takasu Y, Kakeya H, Shin HW, Nakayama K.Cell Struct Funct. 2011;36(2):223-35. 2. Class II ADP-Ribosylation factors are required for efficient secretion of dengue viruses. Kudelko M, Brault JB, Kwok K, Li MY, Pardigon N, Peiris JS, Bruzzone R, Despres P, Nal B, Wang PG.J Biol Chem. 2011 Nov 21. 3. Interaction of phosphodiesterase 3A with brefeldin A-inhibited guanine nucleotide-exchange proteins BIG1 and BIG2 and effect on ARF1 activity. Puxeddu E, Uhart M, Li CC, Ahmad F, Pacheco-Rodriguez G, Manganiello VC, Moss J, Vaughan M.Proc Natl Acad Sci U S A. 2009 Apr 14;106(15):6158-63. Epub 2009 Mar 30. 4. EFA6 facilitates the assembly of the tight junction by coordinating an Arf6-dependent and independent pathway. Klein S, Partisani M, Franco M, Luton F.J Biol Chem. 2008 Oct 31;283(44):30129-38. Epub 2008 Sep 8. 5. The brefeldin A-inhibited guanine nucleotide-exchange protein, BIG2, regulates the constitutive release of TNFR1 exosome-like vesicles. Islam A, Shen X, Hiroi T, Moss J, Vaughan M, Levine SJ.J Biol Chem. 2007 Mar 30;282(13):9591-9. Epub 2007 Feb 2.

NCBI and Uniprot Product Information

• NCBI GI #: 12804364
• NCBI GeneID: 381
• UniProt Accession #: P84085; P26437
• Molecular Weight: 20,530 Da
• NCBI Official Full Name: Homo sapiens ADP-ribosylation factor 5, mRNA
• NCBI Official Synonym Full Names: ADP ribosylation factor 5
• NCBI Official Symbol: ARF5
• NCBI Protein Information: ADP-ribosylation factor 5
• UniProt Protein Name: ADP-ribosylation factor 5
• Protein Family: Auxin response factor
• UniProt Gene Name: ARF5
• UniProt Entry Name: ARF5_HUMAN

NCBI Description

This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010]

Uniprot Description

ARF5: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP- ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein, monomeric, ARF; G protein; G protein, monomeric; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7q31.3

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; plasma membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: vesicle-mediated transport; protein transport; metabolic process; small GTPase mediated signal transduction