Mouse anti-Human API5 Monoclonal Antibody | anti-API5 antibody

API5 (Apoptosis Inhibitor 5, API 5, API-5, Antiapoptosis Clone 11 Protein, AAC11, AAC-11, API5-like 1, API5L1, Cell Migration-inducing Gene 8 Protein, Fibroblast Growth Factor 2-interacting Factor 2, FIF, MIG8, Migration Inducing Protein MIG8, Protein XAG

Cat. Num. AAA6140627

• Gene Names: API5; AAC11; AAC-11
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: API5; Monoclonal Antibody; API5 (Apoptosis Inhibitor 5; API 5; API-5; Antiapoptosis Clone 11 Protein; AAC11; AAC-11; API5-like 1; API5L1; Cell Migration-inducing Gene 8 Protein; Fibroblast Growth Factor 2-interacting Factor 2; FIF; MIG8; Migration Inducing Protein MIG8; Protein XAG; anti-API5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1C2
• Specificity: Recognizes human API5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 3694

• Applicable Applications for anti-API5 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa400-504 from API5 (AAH17709) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(API5 monoclonal antibody Western Blot analysis of API5 expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to API5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to API5 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged API5 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-API5 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 17389324
• NCBI GeneID: 8539
• NCBI Official Full Name: Homo sapiens apoptosis inhibitor 5, mRNA
• NCBI Official Synonym Full Names: apoptosis inhibitor 5
• NCBI Official Symbol: API5
• NCBI Official Synonym Symbols: AAC11; AAC-11
• NCBI Protein Information: apoptosis inhibitor 5
• Protein Family: Apoptosis inhibitor

NCBI Description

This gene encodes an apoptosis inhibitory protein whose expression prevents apoptosis after growth factor deprivation. This protein suppresses the transcription factor E2F1-induced apoptosis and also interacts with, and negatively regulates Acinus, a nuclear factor involved in apoptotic DNA fragmentation. Its depletion enhances the cytotoxic action of the chemotherapeutic drugs. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]