Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (API5 monoclonal antibody Western Blot analysis of API5 expression in Hela NE.)

Mouse anti-Human API5 Monoclonal Antibody | anti-API5 antibody

API5 (Apoptosis Inhibitor 5, API 5, API-5, Antiapoptosis Clone 11 Protein, AAC11, AAC-11, API5-like 1, API5L1, Cell Migration-inducing Gene 8 Protein, Fibroblast Growth Factor 2-interacting Factor 2, FIF, MIG8, Migration Inducing Protein MIG8, Protein XAG

Gene Names
API5; AAC11; AAC-11
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
API5; Monoclonal Antibody; API5 (Apoptosis Inhibitor 5; API 5; API-5; Antiapoptosis Clone 11 Protein; AAC11; AAC-11; API5-like 1; API5L1; Cell Migration-inducing Gene 8 Protein; Fibroblast Growth Factor 2-interacting Factor 2; FIF; MIG8; Migration Inducing Protein MIG8; Protein XAG; anti-API5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C2
Specificity
Recognizes human API5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
3694
Applicable Applications for anti-API5 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa400-504 from API5 (AAH17709) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(API5 monoclonal antibody Western Blot analysis of API5 expression in Hela NE.)

Western Blot (WB) (API5 monoclonal antibody Western Blot analysis of API5 expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to API5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to API5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to API5 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to API5 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged API5 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged API5 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-API5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens apoptosis inhibitor 5, mRNA
NCBI Official Synonym Full Names
apoptosis inhibitor 5
NCBI Official Symbol
API5
NCBI Official Synonym Symbols
AAC11; AAC-11
NCBI Protein Information
apoptosis inhibitor 5
Protein Family

NCBI Description

This gene encodes an apoptosis inhibitory protein whose expression prevents apoptosis after growth factor deprivation. This protein suppresses the transcription factor E2F1-induced apoptosis and also interacts with, and negatively regulates Acinus, a nuclear factor involved in apoptotic DNA fragmentation. Its depletion enhances the cytotoxic action of the chemotherapeutic drugs. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]

Research Articles on API5

Similar Products

Product Notes

The API5 (Catalog #AAA6130021) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The API5 (Apoptosis Inhibitor 5, API 5, API-5, Antiapoptosis Clone 11 Protein, AAC11, AAC-11, API5-like 1, API5L1, Cell Migration-inducing Gene 8 Protein, Fibroblast Growth Factor 2-interacting Factor 2, FIF, MIG8, Migration Inducing Protein MIG8, Protein XAG reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's API5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the API5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "API5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.