Testing Data
(Detection limit for recombinant GST tagged AP4B1 is approximately 0.1ng/ml as a capture antibody.)
Mouse AP4B1 Monoclonal Antibody | anti-AP4B1 antibody
AP4B1 (Adaptor-Related Protein Complex 4, beta 1 Subunit, BETA-4) (AP)
Gene Names
AP4B1; CPSQ5; SPG47; BETA-4
Applications
ELISA
Purity
Purified
Synonyms
AP4B1; Monoclonal Antibody; AP4B1 (Adaptor-Related Protein Complex 4; beta 1 Subunit; BETA-4) (AP); Adaptor-Related Protein Complex 4; BETA-4; anti-AP4B1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B2
Specificity
Recognizes AP4B1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
739
Applicable Applications for anti-AP4B1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AP4B1 (NP_006585, 640aa-739aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELLLEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged AP4B1 is approximately 0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged AP4B1 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-AP4B1 antibody
The heterotetrameric adaptor protein (AP) complexes sort integral membrane proteins at various stages of the endocytic and secretory pathways. AP4 is composed of 2 large chains, beta-4 (AP4B1) and epsilon-4 (AP4E1; MIM 607244), a medium chain, mu-4 (AP4M1; MIM 602296), and a small chain, sigma-4 (AP4S1; MIM 607243). [supplied by OMIM]
Product Categories/Family for anti-AP4B1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
AP-4 complex subunit beta-1 isoform 1
NCBI Official Synonym Full Names
adaptor related protein complex 4 subunit beta 1
NCBI Official Symbol
AP4B1
NCBI Official Synonym Symbols
CPSQ5; SPG47; BETA-4
NCBI Protein Information
AP-4 complex subunit beta-1
UniProt Protein Name
AP-4 complex subunit beta-1
Protein Family
UniProt Gene Name
AP4B1
UniProt Entry Name
AP4B1_HUMAN
NCBI Description
This gene encodes a subunit of a heterotetrameric adapter-like complex 4 that is involved in targeting proteins from the trans-Golgi network to the endosomal-lysosomal system. Mutations in this gene are associated with cerebral palsy spastic quadriplegic type 5 (CPSQ5) disorder. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Research Articles on AP4B1
Similar Products
Product Notes
The AP4B1 ap4b1 (Catalog #AAA6162199) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AP4B1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AP4B1 ap4b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AP4B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
