Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged AOC3 is 0.3ng/ml as a capture antibody.)

Mouse anti-Human AOC3 Monoclonal Antibody | anti-AOC3 antibody

AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) (Biotin)

Gene Names
AOC3; HPAO; SSAO; VAP1; VAP-1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AOC3; Monoclonal Antibody; AOC3 (Membrane Primary Amine Oxidase; Copper Amine Oxidase; HPAO; Semicarbazide-sensitive Amine Oxidase; SSAO; Vascular Adhesion Protein 1; VAP-1; VAP1) (Biotin); anti-AOC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B8
Specificity
Recognizes human AOC3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-AOC3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa351-451 from AOC3 (NP_003725) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged AOC3 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AOC3 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-AOC3 antibody
Cell adhesion protein that participates in lymphocyte recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin-independent fashion. Has a monoamine oxidase activity. May play a role in adipogenesis.
Product Categories/Family for anti-AOC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,533 Da
NCBI Official Full Name
membrane primary amine oxidase isoform 1
NCBI Official Synonym Full Names
amine oxidase, copper containing 3
NCBI Official Symbol
AOC3
NCBI Official Synonym Symbols
HPAO; SSAO; VAP1; VAP-1
NCBI Protein Information
membrane primary amine oxidase; amine oxidase, copper containing 3 (vascular adhesion protein 1); copper amine oxidase; placenta copper monamine oxidase; semicarbazide-sensitive amine oxidase
UniProt Protein Name
Membrane primary amine oxidase
Protein Family
UniProt Gene Name
AOC3
UniProt Synonym Gene Names
VAP1; SSAO; VAP-1
UniProt Entry Name
AOC3_HUMAN

Uniprot Description

AOC3: Cell adhesion protein that participates in lymphocyte recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin- independent fashion. Has a monoamine oxidase activity. May play a role in adipogenesis. Belongs to the copper/topaquinone oxidase family.

Protein type: Cell adhesion; Oxidoreductase; Amino Acid Metabolism - phenylalanine; Other Amino Acids Metabolism - beta-alanine; Membrane protein, integral; Amino Acid Metabolism - tyrosine; Amino Acid Metabolism - glycine, serine and threonine; EC 1.4.3.21

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: cell surface; microvillus; cytoplasm; plasma membrane; integral to membrane

Molecular Function: amine oxidase activity; protein binding; protein homodimerization activity; copper ion binding; protein heterodimerization activity; cation channel activity; calcium ion binding; quinone binding

Biological Process: response to antibiotic; amine metabolic process; cell adhesion; inflammatory response; cation transport

Similar Products

Product Notes

The AOC3 aoc3 (Catalog #AAA6140615) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AOC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AOC3 aoc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AOC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.