Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged AOC3 is 0.3ng/ml as a capture antibody.)

Mouse anti-Human AOC3 Monoclonal Antibody | anti-AOC3 antibody

AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1)

Gene Names
AOC3; allene oxide cyclase 3; AOC3
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
AOC3; Monoclonal Antibody; AOC3 (Membrane Primary Amine Oxidase; Copper Amine Oxidase; HPAO; Semicarbazide-sensitive Amine Oxidase; SSAO; Vascular Adhesion Protein 1; VAP-1; VAP1); Anti -AOC3 (Membrane Primary Amine Oxidase; anti-AOC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B8
Specificity
Recognizes human AOC3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH*
Applicable Applications for anti-AOC3 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa351-451 from AOC3 (NP_003725) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged AOC3 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AOC3 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-AOC3 antibody
Cell adhesion protein that participates in lymphocyte recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin-independent fashion. Has a monoamine oxidase activity. May play a role in adipogenesis.
Product Categories/Family for anti-AOC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,398 Da
NCBI Official Full Name
allene oxide cyclase 3
NCBI Official Symbol
AOC3
NCBI Official Synonym Symbols
allene oxide cyclase 3; AOC3
NCBI Protein Information
allene oxide cyclase 3
UniProt Protein Name
Allene oxide cyclase 3, chloroplastic
Protein Family
UniProt Gene Name
AOC3
UniProt Entry Name
AOC3_ARATH

NCBI Description

Encodes allene oxide cyclase, one of the enzymes involved in jasmonic acid biosynthesis. One of four genes in Arabidopsis that encode this enzyme. mRNA expression is upregulated in senescing leaves. Note: Nomenclature for Arabidopsis allene oxide cyclase 3 (AOC3, AT3G25780) gene is based on Stenzel et al. 2003 Plant Molecular Biology 51:895-911. AOC3 (AT3G25780) is also referred to as AOC2 in He et al. 2002 Plant Physiology, 128:876-884.

Uniprot Description

Function: Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid.

Catalytic activity: (9Z)-(13S)-12,13-epoxyoctadeca-9,11,15-trienoate = (15Z)-12-oxophyto-10,15-dienoate.

Subcellular location: Plastid › chloroplast Ref.1.

Tissue specificity: Highly expressed in fully developed leaves. Ref.1

Induction: Low local and systemic induction by wounding. Ref.1

Miscellaneous: The four allene oxide cyclase proteins (AOC1, AOC2, AOC3 and AOC4) are encoded by duplicated genes. They are very similar, and most experiments involving antibodies do not discriminate between the different members.

Sequence similarities: Belongs to the allene oxide cyclase family.

Research Articles on AOC3

Similar Products

Product Notes

The AOC3 aoc3 (Catalog #AAA6009220) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AOC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the AOC3 aoc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DVRFQGERLV YEISLQEALA IYGGNSPAAM TTRYVDGGFG MGKYTTPLTR GVDCPYLATY VDWHFLLESQ APKTIRDAFC VFEQNQGLPL RRHHSDLYSH *. It is sometimes possible for the material contained within the vial of "AOC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.