Mouse anti-Human ANP32A Monoclonal Antibody | anti-ANP32A antibody

ANP32A (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member A, Acidic Nuclear Phosphoprotein pp32, Leucine-rich Acidic Nuclear Protein, LANP, Mapmodulin, Potent Heat-stable Protein Phosphatase 2A Inhibitor I1PP2A, Putative HLA-DR-associated Protei

Cat. Num. AAA6130001

• Gene Names: ANP32A; LANP; MAPM; PP32; HPPCn; PHAP1; PHAPI; I1PP2A; C15orf1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ANP32A; Monoclonal Antibody; ANP32A (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member A; Acidic Nuclear Phosphoprotein pp32; Leucine-rich Acidic Nuclear Protein; LANP; Mapmodulin; Potent Heat-stable Protein Phosphatase 2A Inhibitor I1PP2A; Putative HLA-DR-associated Protei; anti-ANP32A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G11-4A5
• Specificity: Recognizes human ANP32A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ANP32A antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-249 from ANP32A (AAH07200) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (53.13kD).)

Western Blot (WB)

(ANP32A monoclonal antibody Western Blot analysis of ANP32A expression in Hela.)

Western Blot (WB)

(ANP32A monoclonal antibody Western Blot analysis of ANP32A expression in Daud.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ANP32A on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ANP32A on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-ANP32A antibody

Antibodies; Apoptosis

References

1. Foamy viral nuclear RNA-export is distinct from other retroviruses. Bodem J, Schied T, Gabriel R, Rammling M, Rethwilm A.J Virol. 2010 Dec 15. 2. Quantitative nano-proteomics for protein complexes (QNanoPX) related to estrogen transcriptional action. Cheng PC, Chang HK, Chen SH.Mol Cell Proteomics. 2009 Oct 5.

NCBI and Uniprot Product Information

• NCBI GI #: 5453880
• NCBI GeneID: 8125
• NCBI Accession #: BC007200; AAH07200
• NCBI GenBank Nucleotide #: NM_006305.3
• UniProt Accession #: P39687; Q53FK4; Q5J8L8; Q7M4N6; B2R6T4
• NCBI Official Full Name: acidic leucine-rich nuclear phosphoprotein 32 family member A
• NCBI Official Synonym Full Names: acidic (leucine-rich) nuclear phosphoprotein 32 family, member A
• NCBI Official Symbol: ANP32A
• NCBI Official Synonym Symbols: LANP; MAPM; PP32; HPPCn; PHAP1; PHAPI; I1PP2A; C15orf1
• NCBI Protein Information: acidic leucine-rich nuclear phosphoprotein 32 family member A; acidic nuclear phosphoprotein pp32; cerebellar leucine rich acidic nuclear protein; hepatopoietin Cn; inhibitor-1 of protein phosphatase-2A; leucine-rich acidic nuclear protein; mapmodulin; po
• UniProt Protein Name: Acidic leucine-rich nuclear phosphoprotein 32 family member A
• Protein Family: Acidic leucine-rich nuclear phosphoprotein 32 family
• UniProt Gene Name: ANP32A
• UniProt Synonym Gene Names: C15orf1; LANP; MAPM; PHAP1; pp32; LANP; PHAPI
• UniProt Entry Name: AN32A_HUMAN

Uniprot Description

ANP32A: Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase- independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1- mediated transcriptional repression. Belongs to the ANP32 family.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 15q23

Cellular Component: nucleoplasm; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; gene expression; nucleocytoplasmic transport