Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (53.13kD).)

Mouse anti-Human ANP32A Monoclonal Antibody | anti-ANP32A antibody

ANP32A (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member A, Acidic Nuclear Phosphoprotein pp32, Leucine-rich Acidic Nuclear Protein, LANP, Mapmodulin, Potent Heat-stable Protein Phosphatase 2A Inhibitor I1PP2A, Putative HLA-DR-associated Protei

Gene Names
ANP32A; LANP; MAPM; PP32; HPPCn; PHAP1; PHAPI; I1PP2A; C15orf1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANP32A; Monoclonal Antibody; ANP32A (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member A; Acidic Nuclear Phosphoprotein pp32; Leucine-rich Acidic Nuclear Protein; LANP; Mapmodulin; Potent Heat-stable Protein Phosphatase 2A Inhibitor I1PP2A; Putative HLA-DR-associated Protei; anti-ANP32A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G11-4A5
Specificity
Recognizes human ANP32A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ANP32A antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-249 from ANP32A (AAH07200) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (53.13kD).)

Western Blot (WB) (Western Blot detection against Immunogen (53.13kD).)

Western Blot (WB)

(ANP32A monoclonal antibody Western Blot analysis of ANP32A expression in Hela.)

Western Blot (WB) (ANP32A monoclonal antibody Western Blot analysis of ANP32A expression in Hela.)

Western Blot (WB)

(ANP32A monoclonal antibody Western Blot analysis of ANP32A expression in Daud.)

Western Blot (WB) (ANP32A monoclonal antibody Western Blot analysis of ANP32A expression in Daud.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ANP32A on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ANP32A on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ANP32A on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ANP32A on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-ANP32A antibody
References
1. Foamy viral nuclear RNA-export is distinct from other retroviruses. Bodem J, Schied T, Gabriel R, Rammling M, Rethwilm A.J Virol. 2010 Dec 15. 2. Quantitative nano-proteomics for protein complexes (QNanoPX) related to estrogen transcriptional action. Cheng PC, Chang HK, Chen SH.Mol Cell Proteomics. 2009 Oct 5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
acidic leucine-rich nuclear phosphoprotein 32 family member A
NCBI Official Synonym Full Names
acidic (leucine-rich) nuclear phosphoprotein 32 family, member A
NCBI Official Symbol
ANP32A
NCBI Official Synonym Symbols
LANP; MAPM; PP32; HPPCn; PHAP1; PHAPI; I1PP2A; C15orf1
NCBI Protein Information
acidic leucine-rich nuclear phosphoprotein 32 family member A; acidic nuclear phosphoprotein pp32; cerebellar leucine rich acidic nuclear protein; hepatopoietin Cn; inhibitor-1 of protein phosphatase-2A; leucine-rich acidic nuclear protein; mapmodulin; po
UniProt Protein Name
Acidic leucine-rich nuclear phosphoprotein 32 family member A
UniProt Gene Name
ANP32A
UniProt Synonym Gene Names
C15orf1; LANP; MAPM; PHAP1; pp32; LANP; PHAPI
UniProt Entry Name
AN32A_HUMAN

Uniprot Description

ANP32A: Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase- independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1- mediated transcriptional repression. Belongs to the ANP32 family.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 15q23

Cellular Component: nucleoplasm; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; gene expression; nucleocytoplasmic transport

Research Articles on ANP32A

Similar Products

Product Notes

The ANP32A anp32a (Catalog #AAA6156516) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANP32A (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member A, Acidic Nuclear Phosphoprotein pp32, Leucine-rich Acidic Nuclear Protein, LANP, Mapmodulin, Potent Heat-stable Protein Phosphatase 2A Inhibitor I1PP2A, Putative HLA-DR-associated Protei reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANP32A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANP32A anp32a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANP32A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.