Mouse anti-Human ANGPT4 Monoclonal Antibody | anti-ANGPT4 antibody

ANGPT4 (Angiopoietin 4, ANG-4, Angiopoietin 3, ANG-3, ANG3, ANG4, MGC138181, MGC138183, PRO0628) (PE)

Cat. Num. AAA6156505

• Gene Names: ANGPT4; AGP4; ANG4; ANG-3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ANGPT4; Monoclonal Antibody; ANGPT4 (Angiopoietin 4; ANG-4; Angiopoietin 3; ANG-3; ANG3; ANG4; MGC138181; MGC138183; PRO0628) (PE); anti-ANGPT4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1B7
• Specificity: Recognizes human ANGPT4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ANGPT4 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa25-112 from human ANGPT4 (NP_057069) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTI
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.68kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ANGPT4 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ANGPT4 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-ANGPT4 antibody

Antibodies; Angiopoietin

NCBI and Uniprot Product Information

• NCBI GI #: 7705276
• NCBI GeneID: 51378
• NCBI Accession #: NP_057069
• NCBI GenBank Nucleotide #: NM_015985
• UniProt Accession #: Q9Y264; Q5TFF4; Q9H4Z4; B4E3J9
• Molecular Weight: 46,416 Da
• NCBI Official Full Name: angiopoietin-4
• NCBI Official Synonym Full Names: angiopoietin 4
• NCBI Official Symbol: ANGPT4
• NCBI Official Synonym Symbols: AGP4; ANG4; ANG-3
• NCBI Protein Information: angiopoietin-4; ANG-4; angiopoietin-3; dJ824F16.2 (angiopoietin 4)
• UniProt Protein Name: Angiopoietin-4
• Protein Family: Angiopoietin
• UniProt Gene Name: ANGPT4
• UniProt Synonym Gene Names: ANG3; ANG4; ANG-4; ANG-3
• UniProt Entry Name: ANGP4_HUMAN

Uniprot Description

ANGPT4: Binds to TEK/TIE2, modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2. Promotes endothelial cell survival, migration and angiogenesis.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: extracellular space; extracellular region

Molecular Function: transmembrane receptor protein tyrosine kinase activator activity; receptor tyrosine kinase binding

Biological Process: negative regulation of angiogenesis; positive regulation of angiogenesis; positive regulation of peptidyl-tyrosine phosphorylation; transmembrane receptor protein tyrosine kinase activation (dimerization); endothelial cell proliferation; positive regulation of blood vessel endothelial cell migration; angiogenesis; blood coagulation; negative regulation of blood vessel endothelial cell migration; leukocyte migration; negative regulation of apoptosis