Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.68kD).)

Mouse anti-Human ANGPT4 Monoclonal Antibody | anti-ANGPT4 antibody

ANGPT4 (Angiopoietin 4, ANG-4, Angiopoietin 3, ANG-3, ANG3, ANG4, MGC138181, MGC138183, PRO0628) APC

Gene Names
ANGPT4; AGP4; ANG4; ANG-3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANGPT4; Monoclonal Antibody; ANGPT4 (Angiopoietin 4; ANG-4; Angiopoietin 3; ANG-3; ANG3; ANG4; MGC138181; MGC138183; PRO0628) APC; anti-ANGPT4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B7
Specificity
Recognizes human ANGPT4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ANGPT4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa25-112 from human ANGPT4 (NP_057069) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTI
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.68kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.68kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ANGPT4 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ANGPT4 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ANGPT4 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ANGPT4 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ANGPT4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,416 Da
NCBI Official Full Name
angiopoietin-4
NCBI Official Synonym Full Names
angiopoietin 4
NCBI Official Symbol
ANGPT4
NCBI Official Synonym Symbols
AGP4; ANG4; ANG-3
NCBI Protein Information
angiopoietin-4; ANG-4; angiopoietin-3; dJ824F16.2 (angiopoietin 4)
UniProt Protein Name
Angiopoietin-4
Protein Family
UniProt Gene Name
ANGPT4
UniProt Synonym Gene Names
ANG3; ANG4; ANG-4; ANG-3
UniProt Entry Name
ANGP4_HUMAN

Uniprot Description

ANGPT4: Binds to TEK/TIE2, modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2. Promotes endothelial cell survival, migration and angiogenesis.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: extracellular space; extracellular region

Molecular Function: transmembrane receptor protein tyrosine kinase activator activity; receptor tyrosine kinase binding

Biological Process: negative regulation of angiogenesis; positive regulation of angiogenesis; positive regulation of peptidyl-tyrosine phosphorylation; transmembrane receptor protein tyrosine kinase activation (dimerization); endothelial cell proliferation; positive regulation of blood vessel endothelial cell migration; angiogenesis; blood coagulation; negative regulation of blood vessel endothelial cell migration; leukocyte migration; negative regulation of apoptosis

Similar Products

Product Notes

The ANGPT4 angpt4 (Catalog #AAA6135293) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANGPT4 (Angiopoietin 4, ANG-4, Angiopoietin 3, ANG-3, ANG3, ANG4, MGC138181, MGC138183, PRO0628) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANGPT4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANGPT4 angpt4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANGPT4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.