Mouse anti-Human AMOT Monoclonal Antibody | anti-AMOT antibody

AMOT (Angiomotin, KIAA1071) (HRP)

Cat. Num. AAA6151194

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AMOT; Monoclonal Antibody; AMOT (Angiomotin; KIAA1071) (HRP); anti-AMOT antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A8
• Specificity: Recognizes human AMOT.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-AMOT antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa361-461 from human AMOT (NP_573572) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged AMOT is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-AMOT antibody

This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Alternative splicing results in multiple transcript variants encoding different isoforms.

Product Categories/Family for anti-AMOT antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 19111150
• NCBI GeneID: 154796
• NCBI Accession #: NP_573572
• NCBI GenBank Nucleotide #: NM_133265
• UniProt Accession #: Q4VCS5
• Molecular Weight: 73kDa
• NCBI Official Full Name: angiomotin isoform 2
• NCBI Official Synonym Full Names: angiomotin
• NCBI Official Symbol: AMOT
• NCBI Protein Information: angiomotin
• UniProt Protein Name: Angiomotin
• Protein Family: Angiomotin
• UniProt Gene Name: AMOT
• UniProt Synonym Gene Names: KIAA1071
• UniProt Entry Name: AMOT_HUMAN

NCBI Description

This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

AMOT: Plays a central role in tight junction maintenance via the complex formed with ARHGAP17, which acts by regulating the uptake of polarity proteins at tight junctions. Appears to regulate endothelial cell migration and tube formation. May also play a role in the assembly of endothelial cell-cell junctions. Belongs to the angiomotin family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: Xq23

Cellular Component: signalosome; ruffle; cell surface; tight junction; endocytic vesicle; lamellipodium; cytoplasm; integral to membrane; stress fiber; actin filament; cytosol; external side of plasma membrane

Molecular Function: angiostatin binding; protein binding; receptor activity

Biological Process: intercellular junction assembly; blood vessel endothelial cell migration; positive regulation of cell size; in utero embryonic development; positive regulation of blood vessel endothelial cell migration; gastrulation with mouth forming second; chemotaxis; regulation of cell migration; negative regulation of angiogenesis; regulation of small GTPase mediated signal transduction; positive regulation of embryonic development; positive regulation of stress fiber formation; negative regulation of vascular permeability; vasculogenesis; actin cytoskeleton organization and biogenesis; cell migration involved in gastrulation