Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human AMOT Monoclonal Antibody | anti-AMOT antibody

AMOT (Angiomotin, KIAA1071) (FITC)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AMOT; Monoclonal Antibody; AMOT (Angiomotin; KIAA1071) (FITC); anti-AMOT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A8
Specificity
Recognizes human AMOT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-AMOT antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa361-461 from human AMOT (NP_573572) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged AMOT is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AMOT is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-AMOT antibody
This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-AMOT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
angiomotin isoform 2
NCBI Official Synonym Full Names
angiomotin
NCBI Official Symbol
AMOT
NCBI Protein Information
angiomotin
UniProt Protein Name
Angiomotin
Protein Family
UniProt Gene Name
AMOT
UniProt Synonym Gene Names
KIAA1071
UniProt Entry Name
AMOT_HUMAN

NCBI Description

This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

AMOT: Plays a central role in tight junction maintenance via the complex formed with ARHGAP17, which acts by regulating the uptake of polarity proteins at tight junctions. Appears to regulate endothelial cell migration and tube formation. May also play a role in the assembly of endothelial cell-cell junctions. Belongs to the angiomotin family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: Xq23

Cellular Component: signalosome; ruffle; cell surface; tight junction; endocytic vesicle; lamellipodium; cytoplasm; integral to membrane; stress fiber; actin filament; cytosol; external side of plasma membrane

Molecular Function: angiostatin binding; protein binding; receptor activity

Biological Process: intercellular junction assembly; blood vessel endothelial cell migration; positive regulation of cell size; in utero embryonic development; positive regulation of blood vessel endothelial cell migration; gastrulation with mouth forming second; chemotaxis; regulation of cell migration; negative regulation of angiogenesis; regulation of small GTPase mediated signal transduction; positive regulation of embryonic development; positive regulation of stress fiber formation; negative regulation of vascular permeability; vasculogenesis; actin cytoskeleton organization and biogenesis; cell migration involved in gastrulation

Research Articles on AMOT

Similar Products

Product Notes

The AMOT amot (Catalog #AAA6145891) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AMOT (Angiomotin, KIAA1071) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AMOT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AMOT amot for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMOT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.