Mouse anti-Human AES Monoclonal Antibody | anti-AES antibody

AES (Amino-terminal Enhancer of Split, Amino Enhancer of Split, Gp130-Associated Protein GAM, Protein ESP1, Protein GRG, GRG) (MaxLight 750)

Cat. Num. AAA6231467

• Gene Names: AES; GRG; ESP1; GRG5; TLE5; AES-1; AES-2; Grg-5
• Reactivity: Human
• Applications: FLISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AES; Monoclonal Antibody; AES (Amino-terminal Enhancer of Split; Amino Enhancer of Split; Gp130-Associated Protein GAM; Protein ESP1; Protein GRG; GRG) (MaxLight 750); anti-AES antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E1
• Specificity: Recognizes human AES.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

• Applicable Applications for anti-AES antibody: FLISA
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-110 from AES (NP_001121) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIER
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-AES antibody

Adhesion to extracellular matrix regulates cell survival through both integrin engagement and appropriate cell spreading. Anoikis is the molecular mechanism of apoptosis induced by integrin detachment. Amino-terminal enhancer of split (AES) is a member of the Groucho/ transducin-like enhancer of split (TLE) family of transcriptional regulators, a group of transcriptional co- repressors that play important roles in neurogenesis, segmentation, and sex determination. AES forms a complex with Bit1 (Bcl-2 inhibitor of transcription 1), a mitochondrial protein that is released into the cytoplasm upon onset of apoptosis. It has been suggested that this complex turns off a survival-promoting gene transcription program controlled by the TLE protein family. Interestingly, apoptosis of cells transfected with AES and Bit1 could be inhibited if the cells were allowed to attach to fibronectin through the a5b1 integrin suggesting that the Bit1-AES pathway contributing to anoikis is regulated by integrins, and in particular, the a5b1 integrin.

Product Categories/Family for anti-AES antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 5706731
• NCBI GeneID: 166
• NCBI Accession #: NP_001121
• NCBI GenBank Nucleotide #: NM_001130
• UniProt Accession #: Q08117; Q12808; Q14CJ1; Q96TG9; Q9UDY9; B2RBL0
• Molecular Weight: 24.1 kDa (217aa) confirmed by MALDI-TOF
• NCBI Official Full Name: amino-terminal enhancer of split isoform b
• NCBI Official Synonym Full Names: amino-terminal enhancer of split
• NCBI Official Symbol: AES
• NCBI Official Synonym Symbols: GRG; ESP1; GRG5; TLE5; AES-1; AES-2; Grg-5
• NCBI Protein Information: amino-terminal enhancer of split
• UniProt Protein Name: Amino-terminal enhancer of split
• Protein Family: Acetyl esterase
• UniProt Gene Name: AES
• UniProt Synonym Gene Names: GRG; GRG5; Amino enhancer of split
• UniProt Entry Name: AES_HUMAN

NCBI Description

The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

AES: Acts as dominant repressor towards other family members. Inhibits NF-kappa-B-regulated gene expression. May be required for the initiation and maintenance of the differentiated state. Belongs to the WD repeat Groucho/TLE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleus

Molecular Function: protein binding; transcription corepressor activity

Biological Process: organ morphogenesis; Wnt receptor signaling pathway; transcription, DNA-dependent; regulation of growth; multicellular organismal development; cellular response to extracellular stimulus; negative regulation of transcription from RNA polymerase II promoter; negative regulation of protein binding; negative regulation of transcription, DNA-dependent; skeletal development