Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human, Mouse ADAMTS17 Monoclonal Antibody | anti-ADAMTS17 antibody

ADAMTS17 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 17, ADAM-TS 17, ADAM-TS17, ADAMTS-17, FLJ16363, FLJ32769) (HRP)

Gene Names
ADAMTS17; WMS4
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADAMTS17; Monoclonal Antibody; ADAMTS17 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 17; ADAM-TS 17; ADAM-TS17; ADAMTS-17; FLJ16363; FLJ32769) (HRP); anti-ADAMTS17 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B7
Specificity
Recognizes human ADAMTS17. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1095
Applicable Applications for anti-ADAMTS17 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.2ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa543-651 from human ADAMTS17 (NP_620688) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(ADAMTS17 monoclonal antibody. Western Blot analysis of ADAMTS17 expression in A-431.)

Western Blot (WB) (ADAMTS17 monoclonal antibody. Western Blot analysis of ADAMTS17 expression in A-431.)

Western Blot (WB)

(ADAMTS17 monoclonal antibody. Western Blot analysis of ADAMTS17 expression in NIH/3T3.)

Western Blot (WB) (ADAMTS17 monoclonal antibody. Western Blot analysis of ADAMTS17 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ADAMTS17 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.2ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ADAMTS17 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.2ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ADAMTS17 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADAMTS17 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ADAMTS17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 17 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase with thrombospondin type 1 motif 17
NCBI Official Symbol
ADAMTS17
NCBI Official Synonym Symbols
WMS4
NCBI Protein Information
A disintegrin and metalloproteinase with thrombospondin motifs 17
UniProt Protein Name
A disintegrin and metalloproteinase with thrombospondin motifs 17
UniProt Gene Name
ADAMTS17
UniProt Synonym Gene Names
ADAM-TS 17; ADAM-TS17; ADAMTS-17

NCBI Description

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature protein, which may promote breast cancer cell growth and survival. Mutations in this gene are associated with a Weill-Marchesani-like syndrome, which is characterized by lenticular myopia, ectopia lentis, glaucoma, spherophakia, and short stature. [provided by RefSeq, May 2016]

Research Articles on ADAMTS17

Similar Products

Product Notes

The ADAMTS17 adamts17 (Catalog #AAA6151096) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADAMTS17 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 17, ADAM-TS 17, ADAM-TS17, ADAMTS-17, FLJ16363, FLJ32769) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ADAMTS17 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADAMTS17 adamts17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAMTS17, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.