Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-TOP2A antibodyParaffin Embedded Tissue: Human Liver cell Cellular Data: hepatocyte of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit TOP2A Polyclonal Antibody | anti-TOP2A antibody

TOP2A antibody - C-terminal region

Gene Names
TOP2A; TOP2; TP2A
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
TOP2A; Polyclonal Antibody; TOP2A antibody - C-terminal region; anti-TOP2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
Sequence Length
1531
Applicable Applications for anti-TOP2A antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 87%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TOP2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-TOP2A antibodyParaffin Embedded Tissue: Human Liver cell Cellular Data: hepatocyte of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-TOP2A antibodyParaffin Embedded Tissue: Human Liver cell Cellular Data: hepatocyte of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-TOP2A Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateTOP2A is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-TOP2A Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateTOP2A is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-TOP2A antibody
This is a rabbit polyclonal antibody against TOP2A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TOP2A is a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromsome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
174kDa
NCBI Official Full Name
DNA topoisomerase 2-alpha
NCBI Official Synonym Full Names
DNA topoisomerase II alpha
NCBI Official Symbol
TOP2A
NCBI Official Synonym Symbols
TOP2; TP2A
NCBI Protein Information
DNA topoisomerase 2-alpha
UniProt Protein Name
DNA topoisomerase 2-alpha
Protein Family
UniProt Gene Name
TOP2A
UniProt Synonym Gene Names
TOP2
UniProt Entry Name
TOP2A_HUMAN

NCBI Description

This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromosome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. [provided by RefSeq, Jul 2010]

Uniprot Description

TOP2A: a DNA topoisomerase. Controls of topological states of DNA by transient breakage and rejoining of DNA. Makes double-strand breaks. Four splice variant isoforms have been described.

Protein type: Isomerase; EC 5.99.1.3

Chromosomal Location of Human Ortholog: 17q21-q22

Cellular Component: nucleoplasm; centriole; nuclear chromosome; viral integration complex; DNA topoisomerase complex (ATP-hydrolyzing); protein complex; nucleolus; condensed chromosome; nucleus

Molecular Function: protein C-terminus binding; DNA topoisomerase (ATP-hydrolyzing) activity; DNA-dependent ATPase activity; ubiquitin binding; protein homodimerization activity; histone deacetylase binding; magnesium ion binding; drug binding; protein binding; enzyme binding; protein kinase C binding; DNA binding; protein heterodimerization activity; chromatin binding; DNA bending activity; ATP binding

Biological Process: DNA unwinding during replication; mitotic recombination; positive regulation of viral genome replication; DNA topological change; positive regulation of apoptosis; sister chromatid segregation; rhythmic process; apoptotic chromosome condensation; regulation of circadian rhythm; embryonic cleavage; chromosome segregation; positive regulation of retroviral genome replication; DNA ligation; resolution of meiotic joint molecules as recombinants; positive regulation of transcription from RNA polymerase II promoter; hemopoietic progenitor cell differentiation; mitotic cell cycle; response to DNA damage stimulus

Research Articles on TOP2A

Similar Products

Product Notes

The TOP2A top2a (Catalog #AAA3224400) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOP2A antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TOP2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TOP2A top2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSKAVTSKKS KGESDDFHMD FDSAVAPRAK SVRAKKPIKY LEESDEDDLF. It is sometimes possible for the material contained within the vial of "TOP2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.