Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.71kD).)

Mouse anti-Human ADAM29 Monoclonal Antibody | anti-ADAM29 antibody

ADAM29 (Disintegrin and Metalloproteinase Domain-containing Protein 29, ADAM 29, Cancer/Testis Antigen 73, CT73) (HRP)

Gene Names
ADAM29; CT73; svph1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADAM29; Monoclonal Antibody; ADAM29 (Disintegrin and Metalloproteinase Domain-containing Protein 29; ADAM 29; Cancer/Testis Antigen 73; CT73) (HRP); anti-ADAM29 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A6
Specificity
Recognizes human ADAM29.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ADAM29 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa339-399 from human ADAM29 (NP_055084) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.71kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.71kD).)

Testing Data

(Detection limit for recombinant GST tagged ADAM29 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADAM29 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-ADAM29 antibody
May be involved in spermatogenesis and fertilization. Seems to be a non catalytic metalloprotease-like protein.
Product Categories/Family for anti-ADAM29 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 76 kDa

Observed: 80 kDa
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 29 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 29
NCBI Official Symbol
ADAM29
NCBI Official Synonym Symbols
CT73; svph1
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 29; cancer/testis antigen 73; metallaproteinase-disintegrin (ADAM29); a disintegrin and metalloproteinase domain 29
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 29
UniProt Gene Name
ADAM29
UniProt Synonym Gene Names
ADAM 29; CT73
UniProt Entry Name
ADA29_HUMAN

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is highly expressed in testis and may be involved in human spermatogenesis. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

ADAM29: a member of the ADAM (a disintegrin and metalloprotease domain) family of Cancer-Testis Antigen (CTAs). CTAs may play roles in embryonal development and tumor transformation or aspects of tumor progression. CTAs were once thought to be silenced in most normal adult tissues, with limited expression in fetal, placental, testis, and ovarian cells. These proteins are now known to be aberrantly expressed in various cancers and many are capable of eliciting humoral and cellular immune responses. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins. May be involved in spermatogenesis and fertilization. Seems to be a non catalytic metalloprotease-like protein. Has been found to be frequently mutated in melanoma. Mutations may play a role in melanoma progression and metastasis. Expressed in leukemias at the mRNA level. Three isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Cancer Testis Antigen (CTA); Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q34

Cellular Component: integral to plasma membrane

Molecular Function: zinc ion binding; metallopeptidase activity; metalloendopeptidase activity

Biological Process: spermatogenesis; proteolysis

Research Articles on ADAM29

Similar Products

Product Notes

The ADAM29 adam29 (Catalog #AAA6151090) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADAM29 (Disintegrin and Metalloproteinase Domain-containing Protein 29, ADAM 29, Cancer/Testis Antigen 73, CT73) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADAM29 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADAM29 adam29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAM29, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.