Mouse anti-Human ADAM29 Monoclonal Antibody | anti-ADAM29 antibody

ADAM29 (Disintegrin and Metalloproteinase Domain-containing Protein 29, ADAM 29, Cancer/Testis Antigen 73, CT73) (AP)

Cat. Num. AAA6129878

• Gene Names: ADAM29; CT73; svph1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ADAM29; Monoclonal Antibody; ADAM29 (Disintegrin and Metalloproteinase Domain-containing Protein 29; ADAM 29; Cancer/Testis Antigen 73; CT73) (AP); anti-ADAM29 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3A6
• Specificity: Recognizes human ADAM29.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ADAM29 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa339-399 from human ADAM29 (NP_055084) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.71kD).)

Testing Data

(Detection limit for recombinant GST tagged ADAM29 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-ADAM29 antibody

May be involved in spermatogenesis and fertilization. Seems to be a non catalytic metalloprotease-like protein.

Product Categories/Family for anti-ADAM29 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 73765552
• NCBI GeneID: 11086
• NCBI Accession #: NP_055084
• NCBI GenBank Nucleotide #: NM_014269
• UniProt Accession #: Q9UKF5; Q4W5F3; Q9UHP1; Q9UKF3; Q9UKF4
• Molecular Weight: Predicted: 76 kDa; ; Observed: 80 kDa
• NCBI Official Full Name: disintegrin and metalloproteinase domain-containing protein 29 preproprotein
• NCBI Official Synonym Full Names: ADAM metallopeptidase domain 29
• NCBI Official Symbol: ADAM29
• NCBI Official Synonym Symbols: CT73; svph1
• NCBI Protein Information: disintegrin and metalloproteinase domain-containing protein 29; cancer/testis antigen 73; metallaproteinase-disintegrin (ADAM29); a disintegrin and metalloproteinase domain 29
• UniProt Protein Name: Disintegrin and metalloproteinase domain-containing protein 29
• Protein Family: Disintegrin and metalloproteinase domain-containing protein
• UniProt Gene Name: ADAM29
• UniProt Synonym Gene Names: ADAM 29; CT73
• UniProt Entry Name: ADA29_HUMAN

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is highly expressed in testis and may be involved in human spermatogenesis. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

ADAM29: a member of the ADAM (a disintegrin and metalloprotease domain) family of Cancer-Testis Antigen (CTAs). CTAs may play roles in embryonal development and tumor transformation or aspects of tumor progression. CTAs were once thought to be silenced in most normal adult tissues, with limited expression in fetal, placental, testis, and ovarian cells. These proteins are now known to be aberrantly expressed in various cancers and many are capable of eliciting humoral and cellular immune responses. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins. May be involved in spermatogenesis and fertilization. Seems to be a non catalytic metalloprotease-like protein. Has been found to be frequently mutated in melanoma. Mutations may play a role in melanoma progression and metastasis. Expressed in leukemias at the mRNA level. Three isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Cancer Testis Antigen (CTA); Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q34

Cellular Component: integral to plasma membrane

Molecular Function: zinc ion binding; metallopeptidase activity; metalloendopeptidase activity

Biological Process: spermatogenesis; proteolysis