Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Mouse anti-Human ADAM12 Monoclonal Antibody | anti-ADAM12 antibody

ADAM12 (Disintegrin and Metalloproteinase Domain-containing Protein 12, ADAM 12, Meltrin-alpha, MLTN, UNQ346/PRO545) (AP)

Gene Names
ADAM12; MCMP; MLTN; CAR10; MLTNA; MCMPMltna; ADAM12-OT1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADAM12; Monoclonal Antibody; ADAM12 (Disintegrin and Metalloproteinase Domain-containing Protein 12; ADAM 12; Meltrin-alpha; MLTN; UNQ346/PRO545) (AP); anti-ADAM12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1G3
Specificity
Recognizes human ADAM12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
909
Applicable Applications for anti-ADAM12 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa208-305 from ADAM12 (NP_003465) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQ*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Testing Data

(Detection limit for recombinant GST tagged ADAM12 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADAM12 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ADAM12 antibody
Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors.
Product Categories/Family for anti-ADAM12 antibody
References
1. TM4SF3 promotes esophageal carcinoma metastasis via upregulating ADAM12m expression. Zhou Z, Ran YL, Hu H, Pan J, Li ZF, Chen LZ, Sun LC, Peng L, Zhao XL, Yu L, Sun LX, Yang ZH.Clin Exp Metastasis. 2008;25(5):537-48. Epub 2008 Mar 26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 12 isoform 1 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 12
NCBI Official Symbol
ADAM12
NCBI Official Synonym Symbols
MCMP; MLTN; CAR10; MLTNA; MCMPMltna; ADAM12-OT1
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 12
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 12
UniProt Gene Name
ADAM12
UniProt Synonym Gene Names
MLTN; ADAM 12
UniProt Entry Name
ADA12_HUMAN

NCBI Description

This gene encodes a member of a family of proteins that are structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. Expression of this gene has been used as a maternal serum marker for pre-natal development. Alternative splicing results in multiple transcript variants encoding different isoforms. Shorter isoforms are secreted, while longer isoforms are membrane-bound form. [provided by RefSeq, Jan 2014]

Uniprot Description

ADAM12: contains a disintegrin and metalloprotease (ADAM) domain 12, which is a member of the ADAM protein family. Involved in skeletal muscle regeneration, specifically at the onset of cell fusion, and the differentiation of macrophage-derived giant cells (MGC) and osteoclasts. 2 alternative splicing isoforms have been described: a shorter secreted form and a longer membrane-bound form. The shorter form stimulates myogenesis.

Protein type: Protease; Membrane protein, integral; EC 3.4.24.-; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 10q26

Cellular Component: nucleoplasm; mitochondrion; integral to membrane; plasma membrane; extracellular region

Molecular Function: protein binding; metallopeptidase activity; zinc ion binding; metalloendopeptidase activity; SH3 domain binding

Biological Process: epidermal growth factor receptor signaling pathway; proteolysis; cell adhesion; myoblast fusion

Research Articles on ADAM12

Similar Products

Product Notes

The ADAM12 adam12 (Catalog #AAA6129875) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADAM12 (Disintegrin and Metalloproteinase Domain-containing Protein 12, ADAM 12, Meltrin-alpha, MLTN, UNQ346/PRO545) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADAM12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADAM12 adam12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAM12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.