Mouse anti-Human ADAM12 Monoclonal Antibody | anti-ADAM12 antibody

ADAM12 (Disintegrin and Metalloproteinase Domain-containing Protein 12, ADAM 12, Meltrin-alpha, MLTN, UNQ346/PRO545) (FITC)

Cat. Num. AAA6145784

• Gene Names: ADAM12; MCMP; MLTN; CAR10; MLTNA; MCMPMltna; ADAM12-OT1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ADAM12; Monoclonal Antibody; ADAM12 (Disintegrin and Metalloproteinase Domain-containing Protein 12; ADAM 12; Meltrin-alpha; MLTN; UNQ346/PRO545) (FITC); anti-ADAM12 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 1G3
• Specificity: Recognizes human ADAM12.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 909

• Applicable Applications for anti-ADAM12 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa208-305 from ADAM12 (NP_003465) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQ*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Testing Data

(Detection limit for recombinant GST tagged ADAM12 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-ADAM12 antibody

Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors.

Product Categories/Family for anti-ADAM12 antibody

Antibodies; Matrix Metalloproteinases

References

1. TM4SF3 promotes esophageal carcinoma metastasis via upregulating ADAM12m expression. Zhou Z, Ran YL, Hu H, Pan J, Li ZF, Chen LZ, Sun LC, Peng L, Zhao XL, Yu L, Sun LX, Yang ZH.Clin Exp Metastasis. 2008;25(5):537-48. Epub 2008 Mar 26.

NCBI and Uniprot Product Information

• NCBI GI #: 73747885
• NCBI GeneID: 8038
• NCBI Accession #: NP_003465
• NCBI GenBank Nucleotide #: NM_003474
• UniProt Accession #: O43184
• NCBI Official Full Name: disintegrin and metalloproteinase domain-containing protein 12 isoform 1 preproprotein
• NCBI Official Synonym Full Names: ADAM metallopeptidase domain 12
• NCBI Official Symbol: ADAM12
• NCBI Official Synonym Symbols: MCMP; MLTN; CAR10; MLTNA; MCMPMltna; ADAM12-OT1
• NCBI Protein Information: disintegrin and metalloproteinase domain-containing protein 12
• UniProt Protein Name: Disintegrin and metalloproteinase domain-containing protein 12
• Protein Family: Disintegrin and metalloproteinase domain-containing protein
• UniProt Gene Name: ADAM12
• UniProt Synonym Gene Names: MLTN; ADAM 12
• UniProt Entry Name: ADA12_HUMAN

NCBI Description

This gene encodes a member of a family of proteins that are structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. Expression of this gene has been used as a maternal serum marker for pre-natal development. Alternative splicing results in multiple transcript variants encoding different isoforms. Shorter isoforms are secreted, while longer isoforms are membrane-bound form. [provided by RefSeq, Jan 2014]

Uniprot Description

ADAM12: contains a disintegrin and metalloprotease (ADAM) domain 12, which is a member of the ADAM protein family. Involved in skeletal muscle regeneration, specifically at the onset of cell fusion, and the differentiation of macrophage-derived giant cells (MGC) and osteoclasts. 2 alternative splicing isoforms have been described: a shorter secreted form and a longer membrane-bound form. The shorter form stimulates myogenesis.

Protein type: Protease; Membrane protein, integral; EC 3.4.24.-; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 10q26

Cellular Component: nucleoplasm; mitochondrion; integral to membrane; plasma membrane; extracellular region

Molecular Function: protein binding; metallopeptidase activity; zinc ion binding; metalloendopeptidase activity; SH3 domain binding

Biological Process: epidermal growth factor receptor signaling pathway; proteolysis; cell adhesion; myoblast fusion