Mouse NKX3-1 Monoclonal Antibody | anti-NKX3-1 antibody

NKX3-1 (Homeobox Protein Nkx-3.1, Homeobox Protein NK-3 Homolog A, NKX3.1, NKX3A) (PE)

Cat. Num. AAA6159106

• Gene Names: NKX3-1; NKX3; BAPX2; NKX3A; NKX3.1
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NKX3-1; Monoclonal Antibody; NKX3-1 (Homeobox Protein Nkx-3.1; Homeobox Protein NK-3 Homolog A; NKX3.1; NKX3A) (PE); anti-NKX3-1 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C7
• Specificity: Recognizes human NKX3-1. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-NKX3-1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa100-210 from human NKX3-1 (NP_006158) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(NKX3-1 monoclonal antibody. Western Blot analysis of NKX3-1 expression in PC-12.)

Western Blot (WB)

(NKX3-1 monoclonal antibody. Western Blot analysis of NKX3-1 expression in Raw 264.7.)

Western Blot (WB)

(NKX3-1 monoclonal antibody. Western Blot analysis of NKX3-1 expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NKX3-1 on NIH/3T3 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NKX3-1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-NKX3-1 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 19923352
• NCBI GeneID: 4824
• NCBI Accession #: NP_006158
• NCBI GenBank Nucleotide #: NM_006167
• UniProt Accession #: Q99801; O15465; Q9H2P4; Q9H2P5; Q9H2P6; Q9H2P7; Q9HBG0
• Molecular Weight: 28.7kDa (257aa)
• NCBI Official Full Name: homeobox protein Nkx-3.1 isoform 1
• NCBI Official Synonym Full Names: NK3 homeobox 1
• NCBI Official Symbol: NKX3-1
• NCBI Official Synonym Symbols: NKX3; BAPX2; NKX3A; NKX3.1
• NCBI Protein Information: homeobox protein Nkx-3.1
• UniProt Protein Name: Homeobox protein Nkx-3.1
• Protein Family: Homeobox protein
• UniProt Gene Name: NKX3-1
• UniProt Synonym Gene Names: NKX3.1; NKX3A
• UniProt Entry Name: NKX31_HUMAN

NCBI Description

This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

NKX3-1: Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Play an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Act as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells. Interacts with serum response factor (SRF). Interacts with SPDEF. Interacts with WDR77. Interacts with TOPORS which polyubiquitinates NKX3-1 and induces its proteasomal degradation. By androgens and, in the LNCAP cell line, by estrogens. Androgenic control may be lost in prostate cancer cells during tumor progression from an androgen-dependent to an androgen- independent phase. Highly expressed in the prostate and, at a lower level, in the testis. Belongs to the NK-3 homeobox family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Tumor suppressor; Transcription factor

Chromosomal Location of Human Ortholog: 8p21.2

Cellular Component: intracellular; nucleus

Molecular Function: androgen receptor activity; protein binding; estrogen receptor activity; protein self-association; sequence-specific DNA binding; histone deacetylase binding; estrogen receptor binding; caspase activator activity; transcription factor binding; protein kinase activator activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; salivary gland development; positive regulation of transcription, DNA-dependent; multicellular organismal development; heart development; negative regulation of insulin-like growth factor receptor signaling pathway; positive regulation of caspase activity; positive regulation of mitotic cell cycle; negative regulation of cell proliferation; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; protein kinase B signaling cascade; negative regulation of mitotic cell cycle; negative regulation of epithelial cell proliferation; caspase activation; somitogenesis; pharyngeal system development; male gonad development; response to testosterone stimulus; positive regulation of phosphoinositide 3-kinase cascade; branching morphogenesis of a tube; positive regulation of protein kinase activity; positive regulation of cell division; androgen receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; positive regulation of protein amino acid phosphorylation; negative regulation of transcription, DNA-dependent; metanephros development