Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AASDHPPT expression in transfected 293T cell line by AASDHPPT monoclonal antibody. Lane 1: AASDHPPT transfected lysate (35.8kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human AASDHPPT Monoclonal Antibody | anti-AASDHPPT antibody

AASDHPPT (L-aminoadipate-semialdehyde Dehydrogenase-phosphopantetheinyl Transferase, 4'-phosphopantetheinyl Transferase, Alpha-aminoadipic Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase, AASD-PPT, LYS5 ortholog, CGI-80, HAH-P, HSPC223, x0005,

Gene Names
AASDHPPT; LYS2; LYS5; CGI-80; AASD-PPT
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AASDHPPT; Monoclonal Antibody; AASDHPPT (L-aminoadipate-semialdehyde Dehydrogenase-phosphopantetheinyl Transferase; 4'-phosphopantetheinyl Transferase; Alpha-aminoadipic Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase; AASD-PPT; LYS5 ortholog; CGI-80; HAH-P; HSPC223; x0005; ; anti-AASDHPPT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C12
Specificity
Recognizes human AASDHPPT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-AASDHPPT antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-310 from human AASDHPPT (AAH15470) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTARGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGAGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AASDHPPT expression in transfected 293T cell line by AASDHPPT monoclonal antibody. Lane 1: AASDHPPT transfected lysate (35.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AASDHPPT expression in transfected 293T cell line by AASDHPPT monoclonal antibody. Lane 1: AASDHPPT transfected lysate (35.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AASDHPPT antibody
AASDHPPT is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.
Product Categories/Family for anti-AASDHPPT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
35,776 Da
NCBI Official Full Name
Homo sapiens aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, mRNA
NCBI Official Synonym Full Names
aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
NCBI Official Symbol
AASDHPPT
NCBI Official Synonym Symbols
LYS2; LYS5; CGI-80; AASD-PPT
NCBI Protein Information
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; LYS5 ortholog; 4'-phosphopantetheinyl transferase; alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase
UniProt Protein Name
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
UniProt Gene Name
AASDHPPT
UniProt Synonym Gene Names
AASD-PPT
UniProt Entry Name
ADPPT_HUMAN

NCBI Description

The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq, Jul 2008]

Uniprot Description

AASDHPPT: Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'- phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN. Belongs to the P-Pant transferase superfamily. AcpS family.

Protein type: EC 2.7.8.-; Amino Acid Metabolism - lysine degradation; Transferase; Amino Acid Metabolism - lysine biosynthesis

Chromosomal Location of Human Ortholog: 11q22

Cellular Component: cytosol

Molecular Function: protein binding; phosphopantetheinyltransferase activity; magnesium ion binding

Biological Process: vitamin metabolic process; macromolecule biosynthetic process; pantothenate metabolic process; water-soluble vitamin metabolic process

Research Articles on AASDHPPT

Similar Products

Product Notes

The AASDHPPT aasdhppt (Catalog #AAA6145712) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AASDHPPT (L-aminoadipate-semialdehyde Dehydrogenase-phosphopantetheinyl Transferase, 4'-phosphopantetheinyl Transferase, Alpha-aminoadipic Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase, AASD-PPT, LYS5 ortholog, CGI-80, HAH-P, HSPC223, x0005, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AASDHPPT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AASDHPPT aasdhppt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AASDHPPT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.