Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AASDHPPT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit AASDHPPT Polyclonal Antibody | anti-AASDHPPT antibody

AASDHPPT antibody - C-terminal region

Gene Names
AASDHPPT; ACPS; LYS2; LYS5; CGI-80; AASD-PPT
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AASDHPPT; Polyclonal Antibody; AASDHPPT antibody - C-terminal region; anti-AASDHPPT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE
Sequence Length
309
Applicable Applications for anti-AASDHPPT antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 86%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human AASDHPPT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AASDHPPT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-AASDHPPT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-AASDHPPT antibody
This is a rabbit polyclonal antibody against AASDHPPT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AASDHPPT is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.
Product Categories/Family for anti-AASDHPPT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
NCBI Official Synonym Full Names
aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
NCBI Official Symbol
AASDHPPT
NCBI Official Synonym Symbols
ACPS; LYS2; LYS5; CGI-80; AASD-PPT
NCBI Protein Information
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
UniProt Protein Name
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
UniProt Gene Name
AASDHPPT
UniProt Synonym Gene Names
AASD-PPT
UniProt Entry Name
ADPPT_HUMAN

NCBI Description

The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq, Jul 2008]

Uniprot Description

AASDHPPT: Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'- phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN. Belongs to the P-Pant transferase superfamily. AcpS family.

Protein type: EC 2.7.8.-; Amino Acid Metabolism - lysine degradation; Transferase; Amino Acid Metabolism - lysine biosynthesis

Chromosomal Location of Human Ortholog: 11q22

Cellular Component: cytosol

Molecular Function: protein binding; phosphopantetheinyltransferase activity; magnesium ion binding

Biological Process: vitamin metabolic process; macromolecule biosynthetic process; pantothenate metabolic process; water-soluble vitamin metabolic process

Research Articles on AASDHPPT

Similar Products

Product Notes

The AASDHPPT aasdhppt (Catalog #AAA3209161) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AASDHPPT antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AASDHPPT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AASDHPPT aasdhppt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRHQDVPSQD DSKPTQRQFT ILNFNDLMSS AVPMTPEDPS FWDCFCFTEE. It is sometimes possible for the material contained within the vial of "AASDHPPT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.