Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human 14-3-3 zeta Monoclonal Antibody | anti-YWHAD antibody

14-3-3 zeta (14-3-3 Protein zeta/delta, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAZ) (PE)

Gene Names
YWHAZ; HEL4; YWHAD; KCIP-1; HEL-S-3; 14-3-3-zeta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
14-3-3 zeta; Monoclonal Antibody; 14-3-3 zeta (14-3-3 Protein zeta/delta; Protein Kinase C Inhibitor Protein 1; KCIP-1; YWHAZ) (PE); anti-YWHAD antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B3
Specificity
Recognizes human YWHAZ.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-YWHAD antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa51-150 of human YWHAZ (NP_003397.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody. Lane 1: YWHAZ transfected lysate (27.7kD). Lane 2: Non-transfected lysate. )

Testing Data

(Detection limit for recombinant GST tagged YWHAZ is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-YWHAD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,333 Da
NCBI Official Full Name
14-3-3 protein zeta/delta
NCBI Official Synonym Full Names
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
NCBI Official Symbol
YWHAZ
NCBI Official Synonym Symbols
HEL4; YWHAD; KCIP-1; HEL-S-3; 14-3-3-zeta
NCBI Protein Information
14-3-3 protein zeta/delta; 14-3-3 zeta; 14-3-3 delta; phospholipase A2; epididymis luminal protein 4; epididymis secretory protein Li 3; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; 14-3-3 protein/cytosolic phospholipase A2;
UniProt Protein Name
14-3-3 protein zeta/delta
UniProt Gene Name
YWHAZ
UniProt Synonym Gene Names
KCIP-1
UniProt Entry Name
1433Z_HUMAN

NCBI Description

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

14-3-3 zeta: a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. A multifunctional regulator of the cell signaling processes. Phosphorylation apparently disrupts homodimerization.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 8q23.1

Cellular Component: extracellular space; protein complex; mast cell granule; cytoplasmic vesicle membrane; focal adhesion; mitochondrion; postsynaptic density; leading edge; cytosol; nucleoplasm; perinuclear region of cytoplasm; cytoplasm; melanosome; nucleus

Molecular Function: identical protein binding; protein domain specific binding; protein binding; protein complex binding; protein kinase binding; transcription factor binding

Biological Process: response to drug; platelet activation; histamine secretion by mast cell; establishment of Golgi localization; apoptosis; gene expression; signal transduction; blood coagulation; protein targeting to mitochondrion; negative regulation of apoptosis

Research Articles on YWHAD

Similar Products

Product Notes

The YWHAD ywhaz (Catalog #AAA6161110) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The 14-3-3 zeta (14-3-3 Protein zeta/delta, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAZ) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's 14-3-3 zeta can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the YWHAD ywhaz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "14-3-3 zeta, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual