Mouse anti-Human 14-3-3 zeta Monoclonal Antibody | anti-YWHAD antibody

14-3-3 zeta (14-3-3 Protein zeta/delta, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAZ) (FITC)

Cat. Num. AAA6150504

• Gene Names: YWHAZ; HEL4; YWHAD; KCIP-1; HEL-S-3; 14-3-3-zeta
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: 14-3-3 zeta; Monoclonal Antibody; 14-3-3 zeta (14-3-3 Protein zeta/delta; Protein Kinase C Inhibitor Protein 1; KCIP-1; YWHAZ) (FITC); anti-YWHAD antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B3
• Specificity: Recognizes human YWHAZ.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-YWHAD antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa51-150 of human YWHAZ (NP_003397.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQ
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody. Lane 1: YWHAZ transfected lysate (27.7kD). Lane 2: Non-transfected lysate. )

Testing Data

(Detection limit for recombinant GST tagged YWHAZ is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-YWHAD antibody

Antibodies; 14-3-3

NCBI and Uniprot Product Information

• NCBI GI #: 4507953
• NCBI GeneID: 7534
• NCBI Accession #: NP_003397.1
• NCBI GenBank Nucleotide #: NM_003406.2
• UniProt Accession #: P63104; P29213; P29312; Q32P43; Q5XJ08; Q6GPI2; Q6IN74; Q6NUR9; Q6P3U9; Q86V33; A8K1N0; B7Z465
• Molecular Weight: 19,333 Da
• NCBI Official Full Name: 14-3-3 protein zeta/delta
• NCBI Official Synonym Full Names: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
• NCBI Official Symbol: YWHAZ
• NCBI Official Synonym Symbols: HEL4; YWHAD; KCIP-1; HEL-S-3; 14-3-3-zeta
• NCBI Protein Information: 14-3-3 protein zeta/delta; 14-3-3 zeta; 14-3-3 delta; phospholipase A2; epididymis luminal protein 4; epididymis secretory protein Li 3; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; 14-3-3 protein/cytosolic phospholipase A2
• UniProt Protein Name: 14-3-3 protein zeta/delta
• UniProt Gene Name: YWHAZ
• UniProt Synonym Gene Names: KCIP-1
• UniProt Entry Name: 1433Z_HUMAN

NCBI Description

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

14-3-3 zeta: a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. A multifunctional regulator of the cell signaling processes. Phosphorylation apparently disrupts homodimerization.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 8q23.1

Cellular Component: extracellular space; protein complex; mast cell granule; cytoplasmic vesicle membrane; focal adhesion; mitochondrion; postsynaptic density; leading edge; cytosol; nucleoplasm; perinuclear region of cytoplasm; cytoplasm; melanosome; nucleus

Molecular Function: identical protein binding; protein domain specific binding; protein binding; protein complex binding; protein kinase binding; transcription factor binding

Biological Process: response to drug; platelet activation; histamine secretion by mast cell; establishment of Golgi localization; apoptosis; gene expression; signal transduction; blood coagulation; protein targeting to mitochondrion; negative regulation of apoptosis