Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Matrix metalloproteinase-16 (MMP16) Recombinant Protein | MMP16 recombinant protein

Recombinant Human Matrix metalloproteinase-16 (MMP16), partial

Gene Names
MMP16; MMP-X2; C8orf57; MT-MMP2; MT-MMP3; MT3-MMP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Matrix metalloproteinase-16 (MMP16); Recombinant Human Matrix metalloproteinase-16 (MMP16); partial; MMP16 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
120-564aa, Extracellular domain
Sequence
YALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTASTVKA
Sequence Length
457
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MMP16 recombinant protein
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP s are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another a soluble form of the protein. Both forms of the protein activate MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,515 Da
NCBI Official Full Name
matrix metalloproteinase-16
NCBI Official Synonym Full Names
matrix metallopeptidase 16
NCBI Official Symbol
MMP16
NCBI Official Synonym Symbols
MMP-X2; C8orf57; MT-MMP2; MT-MMP3; MT3-MMP
NCBI Protein Information
matrix metalloproteinase-16
UniProt Protein Name
Matrix metalloproteinase-16
Protein Family
UniProt Gene Name
MMP16
UniProt Synonym Gene Names
MMP-16; MT-MMP 3; MTMMP3; MT3-MMP; MT3MMP

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein activates MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16. [provided by RefSeq, Oct 2010]

Uniprot Description

Endopeptidase that degrades various components of the extracellular matrix, such as collagen type III and fibronectin. Activates progelatinase A. Involved in the matrix remodeling of blood vessels. Isoform short cleaves fibronectin and also collagen type III, but at lower rate. It has no effect on type I, II, IV and V collagen. However, upon interaction with CSPG4, it may be involved in degradation and invasion of type I collagen by melanoma cells.

Research Articles on MMP16

Similar Products

Product Notes

The MMP16 mmp16 (Catalog #AAA958968) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 120-564aa, Extracellular domain. The amino acid sequence is listed below: YALTGQKWQH KHITYSIKNV TPKVGDPETR KAIRRAFDVW QNVTPLTFEE VPYSELENGK RDVDITIIFA SGFHGDSSPF DGEGGFLAHA YFPGPGIGGD THFDSDEPWT LGNPNHDGND LFLVAVHELG HALGLEHSND PTAIMAPFYQ YMETDNFKLP NDDLQGIQKI YGPPDKIPPP TRPLPTVPPH RSIPPADPRK NDRPKPPRPP TGRPSYPGAK PNICDGNFNT LAILRREMFV FKDQWFWRVR NNRVMDGYPM QITYFWRGLP PSIDAVYENS DGNFVFFKGN KYWVFKDTTL QPGYPHDLIT LGSGIPPHGI DSAIWWEDVG KTYFFKGDRY WRYSEEMKTM DPGYPKPITV WKGIPESPQG AFVHKENGFT YFYKGKEYWK FNNQILKVEP GYPRSILKDF MGCDGPTDRV KEGHSPPDDV DIVIKLDNTA STVKA. It is sometimes possible for the material contained within the vial of "Matrix metalloproteinase-16 (MMP16), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.