Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Matrix metalloproteinase-14 (MMP14) Recombinant Protein | MMP14 recombinant protein

Recombinant Human Matrix metalloproteinase-14 (MMP14)

Gene Names
MMP14; MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; WNCHRS; MT1-MMP; MT-MMP 1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Matrix metalloproteinase-14 (MMP14); Recombinant Human Matrix metalloproteinase-14 (MMP14); Matrix metalloproteinase-14; MMP-14; EC=3.4.24.80; MMP-X1; Membrane-type matrix metalloproteinase 1; MT-MMP 1; MTMMP1; Membrane-type-1 matrix metalloproteinase; MT1-MMP; MT1MMP; MMP14 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
112-582aa; Full Length of Mature Protein
Sequence
YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Sequence Length
430
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for MMP14 recombinant protein
Ses to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2.
Product Categories/Family for MMP14 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69.9 kDa
NCBI Official Full Name
matrix metalloproteinase-14 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 14 (membrane-inserted)
NCBI Official Symbol
MMP14
NCBI Official Synonym Symbols
MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; WNCHRS; MT1-MMP; MT-MMP 1
NCBI Protein Information
matrix metalloproteinase-14; membrane type 1 metalloprotease; membrane-type-1 matrix metalloproteinase
UniProt Protein Name
Matrix metalloproteinase-14
Protein Family
UniProt Gene Name
MMP14
UniProt Synonym Gene Names
MMP-14; MT-MMP 1; MTMMP1; MT1-MMP; MT1MMP
UniProt Entry Name
MMP14_HUMAN

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion. [provided by RefSeq, Jul 2008]

Uniprot Description

MMP14: Seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Up-regulated by NANOS1. Expressed in stromal cells of colon, breast, and head and neck. Expressed in lung tumors. Belongs to the peptidase M10A family.

Protein type: Motility/polarity/chemotaxis; EC 3.4.24.80; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: extracellular matrix; focal adhesion; integral to plasma membrane; Golgi lumen; cytoplasm; melanosome; plasma membrane

Molecular Function: integrin binding; protein binding; protease activator activity; zinc ion binding; metalloendopeptidase activity; calcium ion binding; transcription factor activity

Biological Process: extracellular matrix organization and biogenesis; tissue remodeling; negative regulation of focal adhesion formation; male gonad development; embryonic cranial skeleton morphogenesis; proteolysis; positive regulation of cell growth; collagen catabolic process; extracellular matrix disassembly; branching morphogenesis of a tube; ovarian follicle development; regulation of transcription, DNA-dependent; response to estrogen stimulus; response to mechanical stimulus; endothelial cell proliferation; response to hypoxia; zymogen activation; angiogenesis; response to oxidative stress; astrocyte cell migration; lung development; positive regulation of cell migration; endochondral ossification

Disease: Winchester Syndrome

Research Articles on MMP14

Similar Products

Product Notes

The MMP14 mmp14 (Catalog #AAA950814) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 112-582aa; Full Length of Mature Protein. The amino acid sequence is listed below: YAIQGLKWQH NEITFCIQNY TPKVGEYATY EAIRKAFRVW ESATPLRFRE VPYAYIREGH EKQADIMIFF AEGFHGDSTP FDGEGGFLAH AYFPGPNIGG DTHFDSAEPW TVRNEDLNGN DIFLVAVHEL GHALGLEHSS DPSAIMAPFY QWMDTENFVL PDDDRRGIQQ LYGGESGFPT KMPPQPRTTS RPSVPDKPKN PTYGPNICDG NFDTVAMLRG EMFVFKERWF WRVRNNQVMD GYPMPIGQFW RGLPASINTA YERKDGKFVF FKGDKHWVFD EASLEPGYPK HIKELGRGLP TDKIDAALFW MPNGKTYFFR GNKYYRFNEE LRAVDSEYPK NIKVWEGIPE SPRGSFMGSD EVFTYFYKGN KYWKFNNQKL KVEPGYPKSA LRDWMGCPSG GRPDEGTEEE TEVIIIEVDE EGGGAVSAAA VVLPVLLLLL VLAVGLAVFF FRRHGTPRRL LYCQRSLLDK V. It is sometimes possible for the material contained within the vial of "Matrix metalloproteinase-14 (MMP14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.