Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EHMT1 monoclonal antibody (M04), clone 1H2 Western Blot analysis of EHMT1 expression in MES-SA/Dx5 (Cat # L021V1).)

Mouse EHMT1 Monoclonal Antibody | anti-EHMT1 antibody

EHMT1 (Euchromatic Histone-Lysine N-Methyltransferase 1, DEL9q34, DKFZp667M072, EUHMTASE1, Eu-HMTase1, FLJ12879, FP13812, GLP, KIAA1876, KMT1D, bA188C12.1) (PE)

Gene Names
EHMT1; GLP; GLP1; KMT1D; KLEFS1; FP13812; EHMT1-IT1; EUHMTASE1; Eu-HMTase1
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
EHMT1; Monoclonal Antibody; EHMT1 (Euchromatic Histone-Lysine N-Methyltransferase 1; DEL9q34; DKFZp667M072; EUHMTASE1; Eu-HMTase1; FLJ12879; FP13812; GLP; KIAA1876; KMT1D; bA188C12.1) (PE); Euchromatic Histone-Lysine N-Methyltransferase 1; bA188C12.1; anti-EHMT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H2
Specificity
Recognizes EHMT1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1298
Applicable Applications for anti-EHMT1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EHMT1 (NP_079033, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(EHMT1 monoclonal antibody (M04), clone 1H2 Western Blot analysis of EHMT1 expression in MES-SA/Dx5 (Cat # L021V1).)

Western Blot (WB) (EHMT1 monoclonal antibody (M04), clone 1H2 Western Blot analysis of EHMT1 expression in MES-SA/Dx5 (Cat # L021V1).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to EHMT1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to EHMT1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to EHMT1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to EHMT1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-EHMT1 antibody
The protein encoded by this gene is a histone methyltransferase that is part of the E2F6 complex, which represses transcription. The encoded protein methylates the Lys-9 position of histone H3, which tags it for transcriptional repression. This protein may be involved in the silencing of MYC- and E2F-responsive genes and therefore could play a role in the G0/G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-EHMT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
histone-lysine N-methyltransferase EHMT1 isoform 1
NCBI Official Synonym Full Names
euchromatic histone lysine methyltransferase 1
NCBI Official Symbol
EHMT1
NCBI Official Synonym Symbols
GLP; GLP1; KMT1D; KLEFS1; FP13812; EHMT1-IT1; EUHMTASE1; Eu-HMTase1
NCBI Protein Information
histone-lysine N-methyltransferase EHMT1
UniProt Protein Name
Histone-lysine N-methyltransferase EHMT1
UniProt Gene Name
EHMT1
UniProt Synonym Gene Names
EUHMTASE1; GLP; KIAA1876; KMT1D; Eu-HMTase1; GLP; GLP1; H3-K9-HMTase 5

NCBI Description

The protein encoded by this gene is a histone methyltransferase that methylates the lysine-9 position of histone H3. This action marks the genomic region packaged with these methylated histones for transcriptional repression. This protein may be involved in the silencing of MYC- and E2F-responsive genes and therefore could play a role in the G0/G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome, also known as Kleefstra syndrome). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2017]

Uniprot Description

EHMT1: Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. During G0 phase, it probably contributes to silencing of MYC- and E2F-responsive genes, suggesting a role in G0/G1 transition in cell cycle. In addition to the histone methyltransferase activity, also methylates non- histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53. Defects in EHMT1 are the cause of chromosome 9q subtelomeric deletion syndrome (9q- syndrome). Common features seen in these patients are severe mental retardation, hypotonia, brachy(micro)cephaly, epileptic seizures, flat face with hypertelorism, synophrys, anteverted nares, cupid bow or tented upper lip, everted lower lip, prognathism, macroglossia, conotruncal heart defects, and behavioral problems. Belongs to the histone-lysine methyltransferase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - lysine degradation; EC 2.1.1.43; Methyltransferase; Methyltransferase, protein lysine

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: nuclear body; nucleoplasm; nucleus

Molecular Function: histone lysine N-methyltransferase activity (H3-K27 specific); histone lysine N-methyltransferase activity (H3-K9 specific); histone-lysine N-methyltransferase activity; methyltransferase activity; p53 binding; protein binding; protein-lysine N-methyltransferase activity

Biological Process: DNA methylation; embryonic development; establishment and/or maintenance of chromatin architecture; histone methylation; negative regulation of transcription, DNA-dependent; peptidyl-lysine di-methylation; peptidyl-lysine mono-methylation

Disease: Kleefstra Syndrome

Research Articles on EHMT1

Similar Products

Product Notes

The EHMT1 ehmt1 (Catalog #AAA6185673) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EHMT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EHMT1 ehmt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EHMT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.