Methylmalonic aciduria and homocystinuria type C protein homolog (MMACHC) Recombinant Protein | MMACHC recombinant protein
Recombinant Chicken Methylmalonic aciduria and homocystinuria type C protein homolog (MMACHC)
Gene Names
MMACHC; CblC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Methylmalonic aciduria and homocystinuria type C protein homolog (MMACHC); Recombinant Chicken Methylmalonic aciduria and homocystinuria type C protein homolog (MMACHC); MMACHC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-238, Full length protein
Sequence
MEERVAERLHGALGPLGFEVHAFKVGWYNAVLQPAFHLPYPDDTLAFVVLSTPSMFDKALKPFVNKERLKIIRDPVDQCVSHHLSSVKEIFPDQKVDVIFDYEILPSRRPKFLAQTAAHVAGAAYYYQRKDVKLDPWGEKKIFGVCIHPKYGGWFAIRGLLLFPDVQVPFLEQSAPVDCVSTEEKRTELLELFNFHWQDGRYRDIIEVKERYSEEQKTYFSTPPAERFRLLGLTRFTE
Sequence Length
238
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MMACHC recombinant protein
The exact function of This protein is not known, however, its C-terminal region shows similarity to TonB, a bacterial protein involved in energy transduction for cobalamin (vitamin B12) uptake. Hence, it is postulated that this protein may have a role in the binding and intracellular trafficking of cobalamin. Mutations in this gene are associated with methylmalonic aciduria and homocystinuria type cblC.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,637 Da
NCBI Official Full Name
methylmalonic aciduria and homocystinuria type C protein homolog
NCBI Official Synonym Full Names
methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria
NCBI Official Symbol
MMACHC
NCBI Official Synonym Symbols
CblC
NCBI Protein Information
methylmalonic aciduria and homocystinuria type C protein homolog
UniProt Protein Name
Methylmalonic aciduria and homocystinuria type C protein homolog
Protein Family
UniProt Gene Name
MMACHC
Uniprot Description
Catalyzes the reductive dealkylation of cyanocobalamin to cob(II)alamin, using FAD or FMN as cofactor and NADPH as cosubstrate. Can also catalyze the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin. Under anaerobic conditions cob(I)alamin is the first product; it is highly reactive and is converted to aquocob(II)alamin in the presence of oxygen. Binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives.
Similar Products
Product Notes
The MMACHC mmachc (Catalog #AAA1463397) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-238, Full length protein. The amino acid sequence is listed below: MEERVAERLH GALGPLGFEV HAFKVGWYNA VLQPAFHLPY PDDTLAFVVL STPSMFDKAL KPFVNKERLK IIRDPVDQCV SHHLSSVKEI FPDQKVDVIF DYEILPSRRP KFLAQTAAHV AGAAYYYQRK DVKLDPWGEK KIFGVCIHPK YGGWFAIRGL LLFPDVQVPF LEQSAPVDCV STEEKRTELL ELFNFHWQDG RYRDIIEVKE RYSEEQKTYF STPPAERFRL LGLTRFTE. It is sometimes possible for the material contained within the vial of "Methylmalonic aciduria and homocystinuria type C protein homolog (MMACHC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
