Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein AF1q (Mllt11) Recombinant Protein | Mllt11 recombinant protein

Recombinant Mouse Protein AF1q (Mllt11)

Gene Names
Mllt11; Af1q; Zfp692; AI839562
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein AF1q (Mllt11); Recombinant Mouse Protein AF1q (Mllt11); Mllt11 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-90, Full length protein
Sequence
MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTPTYESKDSSSVGKMNGQASGTEQKNPEGDPLLEYSTFNFWRAPIASIHSVDLDLL
Sequence Length
90
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Mllt11 recombinant protein
The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in 2 infants with acute myelomonocytic leukemia have been demonstrated. The N-terminal portion of the MLL gene is critical for leukemogenesis in translocations involving band 11q23. This gene encodes 90 amino acids. It was found to be highly expressed in the thymus but not in peripheral lymphoid tissues. In contrast to its restricted distribution in normal hematopoietic tissue, this gene was expressed in all leukemic cell lines tested.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,029 Da
NCBI Official Full Name
protein AF1q
NCBI Official Synonym Full Names
myeloid/lymphoid or mixed-lineage leukemia; translocated to, 11
NCBI Official Symbol
Mllt11
NCBI Official Synonym Symbols
Af1q; Zfp692; AI839562
NCBI Protein Information
protein AF1q
UniProt Protein Name
Protein AF1q
Protein Family
UniProt Gene Name
Mllt11
UniProt Synonym Gene Names
Af1q

Uniprot Description

Cofactor for the transcription factor TCF7. Involved in regulation of lymphoid development by driving multipotent hematopoietic progenitor cells towards a T-cell fate.

Research Articles on Mllt11

Similar Products

Product Notes

The Mllt11 mllt11 (Catalog #AAA967972) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-90, Full length protein. The amino acid sequence is listed below: MRDPVSSQYS SFLFWRMPIP ELDLSELEGL GLSDTPTYES KDSSSVGKMN GQASGTEQKN PEGDPLLEYS TFNFWRAPIA SIHSVDLDLL. It is sometimes possible for the material contained within the vial of "Protein AF1q (Mllt11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.