Mouse anti-Human MLLT6 Monoclonal Antibody | anti-MLLT6 antibody

MLLT6 (Protein AF-17, ALL1-fused Gene from Chromosome 17 Protein, AF17, FLJ23480) (HRP)

Cat. Num. AAA6153551

• Gene Names: MLLT6; AF17
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MLLT6; Monoclonal Antibody; MLLT6 (Protein AF-17; ALL1-fused Gene from Chromosome 17 Protein; AF17; FLJ23480) (HRP); anti-MLLT6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2B6
• Specificity: Recognizes human MLLT6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MLLT6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-462 from human MLLT6 (AAH07237) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLNGLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPSLGNNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGAEGSGGGPKGGTADKGASANQEKG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (76.56kD).)

Testing Data

(Detection limit for recombinant GST tagged MLLT6 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-MLLT6 antibody

Band 11q23 chromosome locations are associated with approximately 10% of patients with acute lymphoblastic leukemia (ALL) and more than 5% of patients with acute myeloid leukemia (AML). 11q23 translocation associated leukemias typically jointly express lymphoid and myeloid markers and exhibit poor prognosis. The gene at 11q23 involved in the translocations is known by multiple names, including ALL1, HRX, MLL, and TRX1. One of the more infrequent translocations, t(11;17)(q23;q21), MLLT6, encodes a protein of 1,093aa, containing a leucine-zipper dimerization motif 3-prime to the fusion point and a cysteine-rich domain at the end terminus that can be arranged in 3 zinc fingers. MMLT6 contains amino acid runs associated with domains involved in transcriptional repression or activation. It has been proposed that MLLT6 represses truncated ALL1 function or inhibits function of the normal protein in leukemic cells.

Product Categories/Family for anti-MLLT6 antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 13938229
• NCBI GeneID: 4302
• Molecular Weight: 112,076 Da
• NCBI Official Full Name: Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 6, mRNA
• NCBI Official Synonym Full Names: MLLT6, PHD finger domain containing
• NCBI Official Symbol: MLLT6
• NCBI Official Synonym Symbols: AF17
• NCBI Protein Information: protein AF-17
• Protein Family: Protein