SDS-PAGE
Methylated-DNA--protein-cysteine methyltransferase Recombinant Protein | SCO6462 recombinant protein
Recombinant human Methylated-DNA--protein-cysteine methyltransferase
Gene Names
SCO6462; SC9B5.29
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Methylated-DNA--protein-cysteine methyltransferase; Recombinant human Methylated-DNA--protein-cysteine methyltransferase; Recombinant human Methylated-DNA--protein-cysteine methyltransferase protein; SCO6462 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
4-238aa; Partial
Sequence
QPAPLERFASRRPQVLAVRTVCDLVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for SCO6462 recombinant protein
Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.
Product Categories/Family for SCO6462 recombinant protein
References
[1] "Isolation and structural characterization of a cDNA clone encoding the human DNA repair protein for O6-alkylguanine."
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
28.7 kDa
NCBI Official Full Name
methylated-DNA-protein-cysteine methyltransferase
NCBI Official Symbol
SCO6462
NCBI Official Synonym Symbols
SC9B5.29
NCBI Protein Information
methylated-DNA-protein-cysteine methyltransferase
Protein Family
NCBI Description
Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma. [provided by RefSeq, Sep 2015]
Research Articles on SCO6462
Similar Products
Product Notes
The SCO6462 (Catalog #AAA958443) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 4-238aa; Partial. The amino acid sequence is listed below: QPAPLERFAS RRPQVLAVRT VCDLVLGKMD KDCEMKRTTL DSPLGKLELS GCEQGLHEIK LLGKGTSAAD AVEVPAPAAV LGGPEPLMQC TAWLNAYFHQ PEAIEEFPVP ALHHPVFQQE SFTRQVLWKL LKVVKFGEVI SYQQLAALAG NPKAARAVGG AMRGNPVPIL IPCHRVVCSS GAVGNYSGGL AVKEWLLAHE GHRLGKPGLG GSSGLAGAWL KGAGATSGSP PAGRN. It is sometimes possible for the material contained within the vial of "Methylated-DNA--protein-cysteine methyltransferase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
