Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SMAD5 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse SMAD5 Monoclonal Antibody | anti-SMAD5 antibody

SMAD5 (SMAD Family Member 5, DKFZp781C1895, DKFZp781O1323, Dwfc, JV5-1, MADH5) (PE)

Gene Names
SMAD5; DWFC; JV5-1; MADH5
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SMAD5; Monoclonal Antibody; SMAD5 (SMAD Family Member 5; DKFZp781C1895; DKFZp781O1323; Dwfc; JV5-1; MADH5) (PE); SMAD Family Member 5; MADH5; anti-SMAD5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A10
Specificity
Recognizes SMAD5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
465
Applicable Applications for anti-SMAD5 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMAD5 (AAH09682, 105aa-182aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMAD5 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SMAD5 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMAD5 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SMAD5 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(SMAD5 monoclonal antibody (M03), clone 3A10 Western Blot analysis of SMAD5 expression in HeLa (Cat # L013V1).)

Western Blot (WB) (SMAD5 monoclonal antibody (M03), clone 3A10 Western Blot analysis of SMAD5 expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged SMAD5 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SMAD5 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-SMAD5 antibody
Mouse monoclonal antibody raised against a partial recombinant SMAD5.
Product Categories/Family for anti-SMAD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
SMAD family member 5
NCBI Official Synonym Full Names
SMAD family member 5
NCBI Official Symbol
SMAD5
NCBI Official Synonym Symbols
DWFC; JV5-1; MADH5
NCBI Protein Information
mothers against decapentaplegic homolog 5

NCBI Description

The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Research Articles on SMAD5

Similar Products

Product Notes

The SMAD5 (Catalog #AAA6184386) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SMAD5 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.