Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Midkine Recombinant Protein | MDK recombinant protein

Recombinant Human Midkine

Gene Names
MDK; MK; ARAP; NEGF2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Midkine; Recombinant Human Midkine; Amphiregulin-associated protein; ARAP; Midgestation and kidney protein; Neurite outgrowth-promoting factor 2; Neurite outgrowth-promoting protein; MDK recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-143aa; Full Length
Sequence
VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Sequence Length
143
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for MDK recombinant protein
Developmentally regulated, secreted growth factor homologous to pleiotrophin (PTN), which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development.
Product Categories/Family for MDK recombinant protein
References
A new family of heparin-binding factors strong conservation of midkine (MK) sequences between the human and the mouse.Tsutsui J., Uehara K., Kadomatsu K., Matsubara S., Muramatsu T.Biochem. Biophys. Res. Commun. 176:792-797(1991) Cloning, characterization and developmental regulation of two members of a novel human gene family of neurite outgrowth-promoting proteins.Kretschmer P.J., Fairhurst J.L., Decker M.M., Chan C.P., Gluzman Y., Boehlen P., Kovesdi I.Growth Factors 5:99-114(1991) Genomic structure of human midkine (MK) , a retinoic acid-responsive growth/differentiation factor.Uehara K., Matsubara S., Kadomatsu K., Tsutsui J., Muramatsu T.J. Biochem. 111:563-567(1992) Structure of the gene coding for the human retinoic acid-inducible factor, MK.Fairhurst J.L., Kretschmer P.J., Gluzman Y., Boehlen P., Kovesdi I.DNA Cell Biol. 12:139-147(1993) Abnormal expression, highly efficient detection and novel truncations of midkine in human tumors, cancers and cell lines.Tao P., Xu D., Lin S., Ouyang G.L., Chang Y., Chen Q., Yuan Y., Zhuo X., Luo Q., Li J., Li B., Ruan L., Li Q., Li Z.Cancer Lett. 253:60-67(2007) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006) Amphiregulin-associated protein complete amino acid sequence of a protein produced by the 12-0-tetradecanoylphorbol-13-acetate-treated human breast adenocarcinoma cell line MCF-7.Shoyab M., McDonald V.L., Dick K., Modrell B., Malik N., Plowman G.D.Biochem. Biophys. Res. Commun. 179:572-578(1991) Identification of novel heparin-releasable proteins, as well as the cytokines midkine and pleiotrophin, in human postheparin plasma.Novotny W.F., Maffi T., Mehta R.L., Milner P.G.Arterioscler. Thromb. 13:1798-1805(1993) Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) Midkine binds to anaplastic lymphoma kinase (ALK) and acts as a growth factor for different cell types.Stoica G.E., Kuo A., Powers C., Bowden E.T., Sale E.B., Riegel A.T., Wellstein A.J. Biol. Chem. 277:35990-35998(2002) Solution structure of midkine, a new heparin-binding growth factor.Iwasaki W., Nagata K., Hatanaka H., Inui T., Kimura T., Muramatsu T., Yoshida K., Tasumi M., Inagaki F.EMBO J. 16:6936-6946(1997)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40.4 kDa
NCBI Official Full Name
midkine isoform a
NCBI Official Synonym Full Names
midkine (neurite growth-promoting factor 2)
NCBI Official Symbol
MDK
NCBI Official Synonym Symbols
MK; ARAP; NEGF2
NCBI Protein Information
midkine
UniProt Protein Name
Midkine
Protein Family
UniProt Gene Name
MDK
UniProt Synonym Gene Names
MK1; NEGF2; MK; ARAP
UniProt Entry Name
MK_HUMAN

NCBI Description

This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]

Uniprot Description

MDK: Developmentally regulated, secreted growth factor homologous to pleiotrophin (PTN), which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development. Belongs to the pleiotrophin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: cell projection; cytoplasm; extracellular region

Molecular Function: growth factor activity; heparin binding

Biological Process: adrenal gland development; behavioral fear response; cell differentiation; cell migration; cerebellar granular layer development; cerebral cortex development; defecation; dentate gyrus development; negative regulation of neuron apoptosis; nervous system development; Notch signaling pathway; positive regulation of cell division; positive regulation of transcription, DNA-dependent; regulation of behavior; response to drug; response to glucocorticoid stimulus; response to wounding; short-term memory; signal transduction

Research Articles on MDK

Similar Products

Product Notes

The MDK mdk (Catalog #AAA966767) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-143aa; Full Length. The amino acid sequence is listed below: VAKKKDKVKK GGPGSECAEW AWGPCTPSSK DCGVGFREGT CGAQTQRIRC RVPCNWKKEF GADCKYKFEN WGACDGGTGT KVRQGTLKKA RYNAQCQETI RVTKPCTPKT KAKAKAKKGK GKD. It is sometimes possible for the material contained within the vial of "Midkine, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.