SDS-PAGE
Methionine aminopeptidase (map) Recombinant Protein | map recombinant protein
Recombinant Mycoplasma pneumoniae Methionine aminopeptidase (map)
Gene Names
map; GT9_orf248
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Methionine aminopeptidase (map); Recombinant Mycoplasma pneumoniae Methionine aminopeptidase (map); Methionine aminopeptidase; MAP; EC=3.4.11.18; Peptidase M; map recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-248aa; Full Length
Sequence
MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYICDAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFECLTN
Sequence Length
248
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for map recombinant protein
Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.
Product Categories/Family for map recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.7 kDa
NCBI Official Full Name
methionine amino peptidase
NCBI Official Symbol
map
NCBI Official Synonym Symbols
GT9_orf248
NCBI Protein Information
methionine amino peptidase
UniProt Protein Name
Methionine aminopeptidase
Protein Family
UniProt Gene Name
map
UniProt Synonym Gene Names
MAP; MetAP
UniProt Entry Name
MAP1_MYCPN
Uniprot Description
Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.
Similar Products
Product Notes
The map map (Catalog #AAA1379844) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-248aa; Full Length. The amino acid sequence is listed below: MVYLKSAREV EQIRQACKIF QEAKAYFTIE RLLGKSLTAI DQALKQFIES KGATCAFHKY QNFPGFNCLS LNETVIHGIA DNRVFGVKDK LTLDIGINLN GYICDAAFTV LGPKAPEPMQ TLLEVTEACF TAVVEPQLRP NNPTGNVSHA IQTYFESKGY YLLKQFGGHG CGIKVHEEPL ILNYGKPDTG TKLEPGMVLC IEPMVMTDSD AMVMHNNSWN VLTPKSRYNC HVEQMYVITT SGFECLTN. It is sometimes possible for the material contained within the vial of "Methionine aminopeptidase (map), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
