Proprotein convertase subtilisin/kexin type 5 Recombinant Protein | Pcsk5 recombinant protein

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5

Cat. Num. AAA954373

• Gene Names: Pcsk5; PC5; PC6; SPC6; b2b585Clo; b2b1549Clo
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Proprotein convertase subtilisin/kexin type 5; Recombinant Mouse Proprotein convertase subtilisin/kexin type 5; Proprotein convertase 5; PC5; Proprotein convertase 6; PC6; Subtilisin-like proprotein convertase 6; SPC6; Subtilisin/kexin-like protease PC5; Pcsk5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 117-452aa; Full Length
• Sequence: DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE
• Sequence Length: 452

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Pcsk5 recombinant protein

Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors.

References

Identification of an isoform with an extremely large Cys-rich region of PC6, a Kex2-like processing endoprotease.Nakagawa T., Murakami K., Nakayama K.FEBS Lett. 327:165-171(1993) Identification and functional expression of a new member of the mammalian Kex2-like processing endoprotease family its striking structural similarity to PACE4.Nakagawa T., Hosaka M., Torii S., Watanabe T., Murakami K., Nakayama K.J. Biochem. 113:132-135(1993) cDNA structure of the mouse and rat subtilisin/kexin-like PC5 a candidate proprotein convertase expressed in endocrine and nonendocrine cells.Lusson J., Vieau D., Hamelin J., Day R., Chretien M., Seidah N.G.Proc. Natl. Acad. Sci. U.S.A. 90:6691-6695(1993) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) The isoforms of proprotein convertase PC5 are sorted to different subcellular compartments.De Bie I., Marcinkiewicz M., Malide D., Lazure C., Nakayama K., Bendayan M., Seidah N.G.J. Cell Biol. 135:1261-1275(1996) SPC4, SPC6, and the novel protease SPC7 are coexpressed with bone morphogenetic proteins at distinct sites during embryogenesis.Constam D.B., Calfon M., Robertson E.J.J. Cell Biol. 134:181-191(1996) Murine subtilisin-like proteinase SPC6 is expressed during embryonic implantation, somitogenesis, and skeletal formation.Rancourt S.L., Rancourt D.E.3.0.CO;2-5>Dev. Genet. 21:75-81(1997)

NCBI and Uniprot Product Information

• NCBI GI #: 299523019
• NCBI GeneID: 18552
• NCBI Accession #: NP_001177412.1
• NCBI GenBank Nucleotide #: NM_001190483.2
• UniProt Accession #: Q04592; Q62040; E9QPB7
• Molecular Weight: 38.7 kDa
• NCBI Official Full Name: proprotein convertase subtilisin/kexin type 5 isoform 1 preproprotein
• NCBI Official Synonym Full Names: proprotein convertase subtilisin/kexin type 5
• NCBI Official Symbol: Pcsk5
• NCBI Official Synonym Symbols: PC5; PC6; SPC6; b2b585Clo; b2b1549Clo
• NCBI Protein Information: proprotein convertase subtilisin/kexin type 5
• UniProt Protein Name: Proprotein convertase subtilisin/kexin type 5
• Protein Family: Proprotein convertase subtilisin/kexin
• UniProt Gene Name: Pcsk5
• UniProt Synonym Gene Names: PC5; PC6; SPC6
• UniProt Entry Name: PCSK5_MOUSE

NCBI Description

This gene encodes a subtilisin-like proprotein convertase that mediates posttranslational endoproteolytic processing of various proprotein substrates traversing the secretory pathway. The encoded protein is an inactive zymogen that undergoes autoproteolytic processing in the endoplasmic reticulum and the Golgi network to generate an active enzyme. Mice lacking the encoded protein die at an early embryonic stage. Conditional inactivation this gene in the epiblast but not in the extraembryonic tissue bypasses embryonic lethality but results in death at birth. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2015]

Uniprot Description

PCSK5: Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2 and CALD1. Belongs to the peptidase S8 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Membrane protein, integral; EC 3.4.21.-

Cellular Component: extracellular region; extracellular space; Golgi apparatus; integral to membrane; membrane; secretory granule

Molecular Function: endopeptidase activity; hydrolase activity; peptidase activity; peptide binding; serine-type endopeptidase activity; serine-type peptidase activity

Biological Process: anterior/posterior pattern formation; cytokine biosynthetic process; determination of left/right symmetry; embryo implantation; embryonic gut development; embryonic skeletal development; female pregnancy; heart development; kidney development; limb morphogenesis; peptide biosynthetic process; peptide hormone processing; protein processing; proteolysis; respiratory tube development; signal peptide processing; viral infectious cycle