Tumor Necrosis Factor Receptor Superfamily Member 4 (Tnfrsf4) Active Protein | Tnfrsf4 active protein
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 4 (Tnfrsf4), Partial
Gene Names
Tnfrsf4; Ox40; ACT35; CD134; Ly-70; Txgp1; TXGP1L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 4 (Tnfrsf4); Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 4 (Tnfrsf4); Partial; Tumor necrosis factor receptor superfamily member 4; Tnfrsf4; OX40; CD134; Txgp1; Tnfrsf4 active protein
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
20-211aa; Extracellular Domain
Sequence
VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Sequence Length
272
Species
Mouse
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Mouse TNFSF4 in functional ELISA is less than 50 ug/ml.
Subcellular Location
Membrane, Single-Pass Type I Membrane Protein
Classification
Drug Target
Subdivision
Immune Checkpoint
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Tnfrsf4 active protein
Relevance: OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs). The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.
Function: Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).
Function: Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).
Product Categories/Family for Tnfrsf4 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
22.1 kDa
NCBI Official Full Name
Tumor necrosis factor receptor superfamily member 4
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 4
NCBI Official Symbol
Tnfrsf4
NCBI Official Synonym Symbols
Ox40; ACT35; CD134; Ly-70; Txgp1; TXGP1L
NCBI Protein Information
tumor necrosis factor receptor superfamily member 4
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 4
Protein Family
UniProt Gene Name
Tnfrsf4
UniProt Synonym Gene Names
Ox40; Txgp1
UniProt Entry Name
TNR4_MOUSE
Uniprot Description
TNFRSF4: Receptor for TNFSF4/OX40L/GP34.
Protein type: Apoptosis; Receptor, misc.; Membrane protein, integral
Cellular Component: cell surface; membrane; plasma membrane; integral to membrane; external side of plasma membrane
Molecular Function: protein binding; tumor necrosis factor receptor activity
Biological Process: regulation of apoptosis; T cell proliferation; tumor necrosis factor-mediated signaling pathway; negative regulation of transcription factor activity; negative regulation of cytokine secretion; programmed cell death; positive regulation of B cell proliferation; cellular defense response; positive regulation of immunoglobulin secretion; negative regulation of transcription, DNA-dependent; regulation of protein kinase activity; inflammatory response
Research Articles on Tnfrsf4
Similar Products
Product Notes
The Tnfrsf4 tnfrsf4 (Catalog #AAA7115130) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-211aa; Extracellular Domain. The amino acid sequence is listed below: VTARRLNCVK HTYPSGHKCC RECQPGHGMV SRCDHTRDTL CHPCETGFYN EAVNYDTCKQ CTQCNHRSGS ELKQNCTPTQ DTVCRCRPGT QPRQDSGYKL GVDCVPCPPG HFSPGNNQAC KPWTNCTLSG KQTRHPASDS LDAVCEDRSL LATLLWETQR PTFRPTTVQS TTVWPRTSEL PSPPTLVTPE GP. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor Receptor Superfamily Member 4 (Tnfrsf4), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
