Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Leukocyte Surface Antigen CD47 (Cd47) Active Protein | Cd47 active protein

Recombinant Mouse Leukocyte Surface Antigen CD47 (Cd47), Partial

Gene Names
Cd47; IAP; Itgp; AA407862; AI848868; AW108519; 9130415E20Rik; B430305P08Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukocyte Surface Antigen CD47 (Cd47); Recombinant Mouse Leukocyte Surface Antigen CD47 (Cd47); Partial; Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6; Cd47 active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
19-158aa; Partial of Isoform 2
Sequence
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP
Sequence Length
324
Species
Mouse
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Mouse SIRPA in functional ELISA is less than 20 ug/ml.
Classification
Drug Target
Subdivision
Immune Checkpoint
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Cd47 active protein
CD47, also known as Integrin-Associated Protein (IAP) and OA3, is a glycosylated atypical member of the immunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellular domain (ECD) with a single Ig-like domain, five membrane-spanning regions with short intervening loops, and C-terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. It plays an important role in memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cellcell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. It may play a role in membrane transport and/or integrin dependent signal transduction. It also prevents premature elimination of red blood cells.
Product Categories/Family for Cd47 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.7 kDa
NCBI Official Full Name
leukocyte surface antigen CD47 isoform 4
NCBI Official Synonym Full Names
CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
NCBI Official Symbol
Cd47
NCBI Official Synonym Symbols
IAP; Itgp; AA407862; AI848868; AW108519; 9130415E20Rik; B430305P08Rik
NCBI Protein Information
leukocyte surface antigen CD47
UniProt Protein Name
Leukocyte surface antigen CD47
Protein Family
UniProt Gene Name
Cd47
UniProt Synonym Gene Names
IAP
UniProt Entry Name
CD47_MOUSE

Uniprot Description

CD47: Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: membrane; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: cell migration; response to bacterium; positive regulation of phagocytosis; positive regulation of cell proliferation; positive regulation of cell-cell adhesion; opsonization; positive regulation of T cell activation; signal transduction; cell adhesion; positive regulation of inflammatory response

Research Articles on Cd47

Similar Products

Product Notes

The Cd47 cd47 (Catalog #AAA7115132) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-158aa; Partial of Isoform 2. The amino acid sequence is listed below: QLLFSNVNSI EFTSCNETVV IPCIVRNVEA QSTEEMFVKW KLNKSYIFIY DGNKNSTTTD QNFTSAKISV SDLINGIASL KMDKRDAMVG NYTCEVTELS REGKTVIELK NRTAFNTDQG SACSYEEEKG GCKLVSWFSP. It is sometimes possible for the material contained within the vial of "Leukocyte Surface Antigen CD47 (Cd47), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.