Hepatitis A Virus Cellular Receptor 2 Homolog (Havcr2) Active Protein | Havcr2 active protein
Recombinant Mouse Hepatitis A Virus Cellular Receptor 2 Homolog (Havcr2), Partial
Gene Names
Havcr2; Tim3; TIM-3; Timd3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hepatitis A Virus Cellular Receptor 2 Homolog (Havcr2); Recombinant Mouse Hepatitis A Virus Cellular Receptor 2 Homolog (Havcr2); Partial; Hepatitis A virus cellular receptor 2 homolog; HAVcr-2; T-cell immunoglobulin and mucin domain-containing protein 3; T-cell immunoglobulin mucin receptor 3; T-cell membrane protein 3; Tim3; Timd3; Havcr2 active protein
Host
Mammalian Cell
Specificity
Expressed in T-helper type 1 lymphocytes. Not expressed by naive T-cells but up-regulated as they differentiate into T-helper-1 cells. Also expressed by differentiated type 1 CD8+ cytotoxic T-cells. Expressed on peritoneal exudate macrophages, monocytes, and splenic dendritic cells (DCs). Expression on natural killer (NK) cells is inversely associated with IFN-gamma production during the initial 24 h of LPS-induced endotoxic shock. Expressed on mast cells.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
20-191aa; Extracellular Domain
Sequence
RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
Sequence Length
281
Species
Mouse
Tag
C-terminal FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human Galectin 9 in functional ELISA is less than 20 ug/ml.
Subcellular Location
Isoform 1: Membrane, Single-Pass Type I Membrane Protein, Cell Junction
Protein Families
Immunoglobulin Superfamily, TIM Family
Classification
Drug Target
Subdivision
Immune Checkpoint
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Havcr2 active protein
Relevance: T cell immunoglobulin and mucin domain-3 (TIM3), also called hepatitis A virus cellular receptor 2 (HAVCR2), is a transmembrane glycoprotein of the TIM family of immune regulating molecules and plays an important role in the Th1-mediated immune response. TIM3 is expressed on the Th1 cells, CD8 T-cells, monocytes, and dendritic cells, but not on Th2 cells. TIM3 expressed by monocytes and dendritic cells facilitates phagocytosis of apoptotic cells and up-regulates cross-presentation of apoptotic cell-associated antigens through interaction with phosphatidylserine. Engagement of TIM3 by its ligand galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. Stimulation of TIM3 with an agonistic antibody promotes inflammation through the activation of innate immune cells. TIM3 is also regarded as a potential target molecule for immunotherapy. TIM3 and programmed cell death 1 (PD-1) as two important coinhibitory regulators of T cell responses, have been implicated with the T-cell dysfunction or exhaustion associated with chronic HBV infection including HBV-related HCC.
Function: Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand.
Function: Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand.
Product Categories/Family for Havcr2 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46.3 kDa
NCBI Official Full Name
hepatitis A virus cellular receptor 2 homolog
NCBI Official Synonym Full Names
hepatitis A virus cellular receptor 2
NCBI Official Symbol
Havcr2
NCBI Official Synonym Symbols
Tim3; TIM-3; Timd3
NCBI Protein Information
hepatitis A virus cellular receptor 2 homolog
UniProt Protein Name
Hepatitis A virus cellular receptor 2 homolog
Protein Family
UniProt Gene Name
Havcr2
UniProt Synonym Gene Names
Tim3; Timd3; HAVcr-2; TIMD-3
UniProt Entry Name
HAVR2_MOUSE
Research Articles on Havcr2
Similar Products
Product Notes
The Havcr2 havcr2 (Catalog #AAA7115131) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-191aa; Extracellular Domain. The amino acid sequence is listed below: RSLENAYVFE VGKNAYLPCS YTLSTPGALV PMCWGKGFCP WSQCTNELLR TDERNVTYQK SSRYQLKGDL NKGDVSLIIK NVTLDDHGTY CCRIQFPGLM NDKKLELKLD IKAAKVTPAQ TAHGDSTTAS PRTLTTERNG SETQTLVTLH NNNGTKISTW ADEIKDSGET IR. It is sometimes possible for the material contained within the vial of "Hepatitis A Virus Cellular Receptor 2 Homolog (Havcr2), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
