Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Sample Type :HeLaPrimary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :SF3A1)

Rabbit SF3A1 Polyclonal Antibody | anti-SF3A1 antibody

SF3A1 antibody - N-terminal region

Gene Names
SF3A1; PRP21; PRPF21; SAP114; SF3A120
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SF3A1; Polyclonal Antibody; SF3A1 antibody - N-terminal region; anti-SF3A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT
Sequence Length
793
Applicable Applications for anti-SF3A1 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SF3A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(Sample Type :HeLaPrimary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :SF3A1)

Immunofluorescence (IF) (Sample Type :HeLaPrimary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :SF3A1)

Immunohistochemistry (IHC)

(Rabbit Anti-SF3A1 antibodyParaffin Embedded Tissue: Human Heartcell Cellular Data: cardiac cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-SF3A1 antibodyParaffin Embedded Tissue: Human Heartcell Cellular Data: cardiac cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-SF3A1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateSF3A1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-SF3A1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateSF3A1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-SF3A1 antibody
This is a rabbit polyclonal antibody against SF3A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs.This gene encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP (also called SWAP or Suppressor-of-White-APricot) motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-SF3A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
splicing factor 3A subunit 1
NCBI Official Synonym Full Names
splicing factor 3a subunit 1
NCBI Official Symbol
SF3A1
NCBI Official Synonym Symbols
PRP21; PRPF21; SAP114; SF3A120
NCBI Protein Information
splicing factor 3A subunit 1
UniProt Protein Name
Splicing factor 3A subunit 1
Protein Family
UniProt Gene Name
SF3A1
UniProt Synonym Gene Names
SAP114; SAP 114
UniProt Entry Name
SF3A1_HUMAN

NCBI Description

This gene encodes a subunit of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer is a component of the mature U2 small nuclear ribonucleoprotein particle (snRNP). U2 small nuclear ribonucleoproteins play a critical role in spliceosome assembly and pre-mRNA splicing. [provided by RefSeq, Aug 2014]

Uniprot Description

SF3A1: subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.

Protein type: RNA-binding; Nuclear receptor co-regulator; Spliceosome; RNA splicing

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: nucleoplasm; spliceosome

Molecular Function: protein binding; RNA binding

Biological Process: nuclear mRNA 3'-splice site recognition; nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression; mRNA processing

Research Articles on SF3A1

Similar Products

Product Notes

The SF3A1 sf3a1 (Catalog #AAA3205361) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SF3A1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SF3A1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SF3A1 sf3a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQTTQQQLPQ KVQAQVIQET IVPKEPPPEF EFIADPPSIS AFDLDVVKLT. It is sometimes possible for the material contained within the vial of "SF3A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.