Ephrin-A4 (EFNA4) Active Protein | EFNA4 active protein

Recombinant Human Ephrin-A4 (EFNA4), Partial

Cat. Num. AAA7115143

• Gene Names: EFNA4; EFL4; EPLG4; LERK4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ephrin-A4 (EFNA4); Recombinant Human Ephrin-A4 (EFNA4); Partial; Ephrin-A4; EPH-Related Receptor Tyrosine Kinase Ligand 4; LERK-4; EFNA4; EPLG4; LERK4; EFNA4 active protein

• Host: Mammalian Cell
• Specificity: Expressed in the adult spleen, lymph node, prostate, ovary, small intestine, and colon, and in fetal heart, lung, liver and kidney. Also detected in hematopoietic cell lines.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Sequence Positions: 26-171aa; Partial
• Sequence: LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
• Sequence Length: 201

• Species: Human
• Tag: C-terminal 6xHis-FC-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human EphA7 in functional ELISA is less than 10 ug/ml.
• Subcellular Location: Isoform 1: Cell Membrane, Lipid-Anchor, GPI-Anchor, SUBCELLULAR LOCATION: Isoform 2: Secreted
• Protein Families: Ephrin Family
• Classification: Other Recombinant Protein
• Pathway: MAPK Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for EFNA4 active protein

Relevance: Ephrin-A4 is a member of the ephrin ligand family which binds members of the Eph receptor family. All ligands share a conserved extracellular sequence, which most likely corresponds to the receptor binding domain. Ephrin-A4 consists of approximately 125 amino acids and includes four invariant cysteines, It has been shown to bind EphA2, EphA3, EphA4, EphA5, EphA6, EphA7, and EphB1. Ephrin-A4 binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. It may play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils.

Function: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils.

Product Categories/Family for EFNA4 active protein

Cardiovascular

NCBI and Uniprot Product Information

• NCBI GI #: 4885197
• NCBI GeneID: 1945
• NCBI Accession #: NP_005218.1
• NCBI GenBank Nucleotide #: NM_005227.3
• UniProt Accession #: P52798
• Molecular Weight: 44.3 kDa
• NCBI Official Full Name: ephrin-A4 isoform a
• NCBI Official Synonym Full Names: ephrin A4
• NCBI Official Symbol: EFNA4
• NCBI Official Synonym Symbols: EFL4; EPLG4; LERK4
• NCBI Protein Information: ephrin-A4
• UniProt Protein Name: Ephrin-A4
• Protein Family: Ephrin
• UniProt Gene Name: EFNA4
• UniProt Synonym Gene Names: EPLG4; LERK4; LERK-4
• UniProt Entry Name: EFNA4_HUMAN

NCBI Description

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNA4: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils. Belongs to the ephrin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: integral to plasma membrane; plasma membrane; extracellular region

Molecular Function: protein binding; transmembrane-ephrin receptor activity; ephrin receptor binding

Biological Process: axon guidance; cell-cell signaling; ephrin receptor signaling pathway; osteoclast differentiation; bone remodeling