Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Ephrin-A4/EFNA4 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 50 kDa.)

Ephrin-A4/EFNA4 Recombinant Protein | EFNA4 recombinant protein

Recombinant Human Ephrin-A4/EFNA4 Protein

Gene Names
EFNA4; EFL4; EPLG4; LERK4
Purity
>80% by SDS-PAGE.
Synonyms
Ephrin-A4/EFNA4; Recombinant Human Ephrin-A4/EFNA4 Protein; EFL4; EPLG4; LERK4; EFNA4 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>80% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
Sequence Length
201
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Ephrin-A4/EFNA4 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 50 kDa.)

SDS-Page (Recombinant Human Ephrin-A4/EFNA4 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 50 kDa.)
Related Product Information for EFNA4 recombinant protein
Description: Recombinant Human Ephrin-A4/EFNA4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu26-Gly171) of human Ephrin-A4/EFNA4 (Accession # NP_005218.1) fused with an Fc, 6xHis tag at the C-terminus.

Background: EPH-related receptor tyrosine kinase ligand 4 (Ephrin-A4) also known as EFNA4, is a member of the Ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Eph/ephrin interactions are implicated in axon guidance, neural crest cell migration, establishment of segmental boundaries, and formation of angiogenic capillary plexi. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. Ephrin-A4/EFNA4 functions as a cell surface GPI-bound ligand for Eph receptor, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development.
Product Categories/Family for EFNA4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ephrin-A4 isoform a
NCBI Official Synonym Full Names
ephrin A4
NCBI Official Symbol
EFNA4
NCBI Official Synonym Symbols
EFL4; EPLG4; LERK4
NCBI Protein Information
ephrin-A4
UniProt Protein Name
Ephrin-A4
Protein Family
UniProt Gene Name
EFNA4
UniProt Synonym Gene Names
EPLG4; LERK4; LERK-4
UniProt Entry Name
EFNA4_HUMAN

NCBI Description

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNA4: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils. Belongs to the ephrin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: integral to plasma membrane; plasma membrane; extracellular region

Molecular Function: protein binding; transmembrane-ephrin receptor activity; ephrin receptor binding

Biological Process: axon guidance; cell-cell signaling; ephrin receptor signaling pathway; osteoclast differentiation; bone remodeling

Research Articles on EFNA4

Similar Products

Product Notes

The EFNA4 efna4 (Catalog #AAA9141760) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LRHVVYWNSS NPRLLRGDAV VELGLNDYLD IVCPHYEGPG PPEGPETFAL YMVDWPGYES CQAEGPRAYK RWVCSLPFGH VQFSEKIQRF TPFSLGFEFL PGETYYYISV PTPESSGQCL RLQVSVCCKE RKSESAHPVG SPGESG. It is sometimes possible for the material contained within the vial of "Ephrin-A4/EFNA4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.